Latest update: September 24, 2018


ProGT31 (XcOGT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT31 (XcOGT)
Organism Information
Organism NameXanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Clinical ImplicationPlant Pathogen
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Xanthomonadaceae
Order: Xanthomonadales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)190485
Genome Information
Gene BankAE008922
EMBLAE008922
Gene Information
Gene NameXCC0866
NCBI Gene ID999532
Protein information
Protein NameXcOGT 
UniProtKB/ SwissProt IDQ8PC69
NCBI Ref SeqNP_636257
UniProtKB Sequence>tr|Q8PC69|Q8PC69_XANCP Uncharacterized protein OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0866 PE=1 SV=1 MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAV ARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQL LPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLAC ARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQM HLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEV FALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSR VVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADA RLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVL TTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRAS GVFHMDGFADDFGALLQALARRHGWLGI
EMBL CDSAAM40181.1
Sequence length568 AA
String190485.XCC0866
PDB ID 2JLB 2VSY 2XGM 2XGO 2XGS
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Experimental_strategiesIn vitro 
Litrature
Year Of Validation2008 
Reference Clarke, A.J., Hurtado-Guerrero, R., Pathak, S., Schüttelkopf, A.W., Borodkin, V., Shepherd, S.M., Ibrahim, A.F.& Van Aalten, D. M. (2008). Structural insights into mechanism and specificity of O-GlcNAc transferase. The EMBO journal, 27(20), 2780-2788.

Authors Clarke, A.J., Hurtado-Guerrero, R., Pathak, S., Schüttelkopf, A.W., Borodkin, V., Shepherd, S.M., Ibrahim, A.F.& Van Aalten, D. M.
Research groupsDivision of Biological Chemistry & Drug Discovery, College of Life Sciences, University of Dundee, Dundee, UK.
Corresponding Author Van Aalten, D. M.
ContactsDivision of Biological Chemistry & Drug Discovery, College of Life Sciences, University of Dundee, Dundee, UK.
Reference Martinez-Fleites, C., Macauley, M. S., He, Y., Shen, D. L., Vocadlo, D. J., & Davies, G. J. (2008). Structure of an O-GlcNAc transferase homolog provides insight into intracellular glycosylation. Nature Structural and Molecular Biology, 15(7), 764.

Authors Martinez-Fleites, C., Macauley, M. S., He, Y., Shen, D. L., Vocadlo, D. J., & Davies, G. J.
Research groupsStructural Biology Laboratory, Department of Chemistry, The University of York, Heslington, York YO10 5YW, UK.
Corresponding Author Davies, G. J.
ContactsStructural Biology Laboratory, Department of Chemistry, The University of York, Heslington, York YO10 5YW, UK.