Latest update: September 24, 2018


ProGT32 (GT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT32 (GT)
Organism Information
Organism NamePeptoclostridium difficile (strain 630) (Clostridium difficile)
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)272563
Genome Information
Gene BankAM180355
EMBLAM180355
Gene Information
Gene NameCD0240
NCBI Gene ID4916758
Protein information
Protein NameGlycosyltransferase 
UniProtKB/ SwissProt IDQ18CX6
NCBI Ref SeqWP_011860691.1
UniProtKB Sequence>tr|Q18CX6|Q18CX6_PEPD6 Glycosyltransferase OS=Peptoclostridium difficile (strain 630) GN=CD630_02400 PE=4 SV=1 MLLSIVMMVKNEENILEKTLKSLSVLRNSIESELIIVDTGSTDNTIRIAKQYTEKVYFHN WNDDFSSMRNISISYAKGEWLLILDADEVLIDYSNIIKFFESGLNKKFNSASVRLKNLYS FDKKLYGYCSVLRFFKNLDFKYCGKVHEQPMYKNPIFNNIADFEHYGYLFEDEEIRINKV KRNEKLLLEELKEDEKSPYTNYQIGKNLIILGKYQEALDYLEKSYKLYSKLEIVPGYLIT NLAKVYLYLGKAKKCEKLCLKYINKDRNNIDIYYHIAQAQVDLGKYENSIDSYKRYIYLL DNYEMSTQANSLLSDTDAVGFRDEAIITLIKIYYKLEKYDLVISEYDNIEDVEKKKNVYF SLFMSLYKLNRFEDIKNYYREIPNSKVERDSFYKSMEDFINNIKDDEKELIYKSLCDIEG NYGLLNKIRINKHVSLDTCRKILNEEKDIVYASVIKIAFEEKVDLLDIFYNMEYVWIEKY LRYILALERSFNVSIYKYIISCPNTSEIEKIRVYKVISKILLESVNLSDKKYKELFYIYI MYSYKYIKYIYSNLSDCELIKFVCNDIDKFTLEFKHVLDGKRKINNPNEKLEYLHNMRIL LNEYPFYNRIIKIFISELEESITESEEFKLLKDNFIIRIENMIENGKINDAKLLIEDYSK TFADDVKILNIKAILFMCEDKFEEADFALKKALSLDLENEDTIYNIEYLENLK
EMBL CDSCAJ67061.1
Sequence length713 AA
Function in Native Organism 1) Inactivation of a glycosyltransferase gene (CD0240) resulted in an inability to produce flagellar filaments at the cell surface.
String272563.CD0240.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT2
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-HexNAc
Glycan Information
Glycan transferredMonosaccharide (HexNAc)  
Method of Glycan IndentificationNanoLC-MS/MS, and MS/MS (ETD)
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name FliC
ProGPdb ID ProGP298
Litrature
Year Of Validation2009 
Reference Twine, S. M., Reid, C. W., Aubry, A., McMullin, D. R., Fulton, K. M., Austin, J., & Logan, S. M. (2009). Motility and flagellar glycosylation in Clostridium difficile. Journal of bacteriology, 191(22), 7050-7062.

Authors Twine, S. M., Reid, C. W., Aubry, A., McMullin, D. R., Fulton, K. M., Austin, J., & Logan, S. M.
Research groupsInstitute for Biological Sciences, National Research Council, 100 Sussex Drive, Ottawa, ON K1A 0R6, Canada.
Corresponding Author Logan, S. M.
ContactsInstitute for Biological Sciences, National Research Council, 100 Sussex Drive, Ottawa, ON K1A 0R6, Canada.