Latest update: September 24, 2018


ProGT35 (Pmt)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT35 (Pmt)
ProGT Pathway
Organism Information
Organism NameStreptomyces coelicolor strain J1929
Clinical ImplicationPlant pathogens
DomainBacteria
PhylumActinobacteria
ClassificationFamily: Streptomycetaceae
Suborder: Streptomycineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)100226
Genome Information
Gene BankAL939115.1
EMBLAL939115.1
Gene Information
Gene NameSCO3154
NCBI Gene ID1098588
Protein information
Protein NamePmt 
UniProtKB/ SwissProt IDQ9RKD3
NCBI Ref SeqNP_627370.1
UniProtKB Sequence>tr|Q9RKD3|Q9RKD3_STRCO Putative integral membrane protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3154 PE=4 SV=1 MHSAVPYDGAVTSTASSTDTLHDQAPHDERPTWQQRLRRFGYPAGPATGDVRDRLVPPYT SPSPRLWAFLGVSKPLTDRMIRWSAWGGPLLVALFAGVLRFWNLGSPKAVIFDETYYAKD AWALIHRGFEVNWDKNANDLILNSGGDVPIPTDAAYVVHPPVGKYIIGLGELLFGFDPFG WRFMTALLGTLSVLLLCRIGRRLFRSTFLGCLAGALMALDGLHFVMSRTALLDSVLMFFV LAAFGCLVVDRDKARSRLAAALPVDEDGRVRPDAHVAETLRLGWRPWRLAAGLMLGLAAA TKWNGLYIMAAFCVMAVLWDVGSRRVAGAHRPYRAVLRHDLGWAFLSTVPVALATYLLSW LGWILSPSDGTGGYYRDWATKDGANSSWSWLFPDWWRSLWHYETQVLEFHTHLTSPHTYQ SNPWSWIVLGRPVSYFYESPSAGSDGCPVDAGEKCAREVLALGTPLLWWVGCFALLYVLW RWLFRRDWRAGAIACGVAAGYLPWFMYQERTIFLFYAVVFLPFLCLAVAMLLGAIIGRPG CTDTRRVAGATGAGVLVLLIAWNFIYFWPLYTGTAIPMEEWRARMWLDTWV
EMBL CDSCAB59650.1
Sequence length591 AA
Subcellular LocationMembrane
Function in Native Organism 1) Pmt transfer the mannose sugar to PstS Protein.
2) Streptomyces coelicolor protein mannosyltransferase (Pmt) is required for glycosylation of the Apa protein.
String100226.SCO3154.
Additional Information1) PMTs are functional orthologues of the PMTs in fungi and POMTs in humans.
2) Streptomyces coelicolor Ppm and Pmt also modify the Apa protein of M.tb.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT39
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityGDP-Mannose
Accessory GT IDProGT35.1
Glycan Information
Glycan transferredTrihexose 
Method of Glycan IndentificationNano-LC-ESI-MS/MS
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name PstS
ProGPdb ID ProGP309
Acceptor Substrate name Apa
ProGPdb ID ProGP51
Litrature
Year Of Validation2009 
Reference Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. & Smith, M. C. M. (2009). Glycosylation of the phosphate binding protein, PstS, in Streptomyces coelicolor by a pathway that resembles protein O?mannosylation in eukaryotes. Molecular microbiology, 71(2), 421-433.

Authors Wehmeier, S., Varghese, A.S., Gurcha, S.S., Tissot, B., Panico, M., Hitchen, P., Morris, H.R., Besra, G.S., Dell, A. & Smith, M. C. M.
Research groupsSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
Corresponding Author Smith, M. C. M.
ContactsSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
Reference Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L. (2014). Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor. FEMS microbiology letters, 350(1), 72-82.

Authors Córdova-Dávalos, L. E., Espitia, C., González-Cerón, G., Arreguín-Espinosa, R., Soberón-Chávez, G., & Servín-González, L.
Research groupsSchool of Medical Sciences, Institute of Medical Sciences, University of Aberdeen, Aberdeen AB25 2ZD, UK.
Corresponding Author Servín-González, L.
ContactsDepartment of Molecular Biology and Biotechnology, Biomedical Research Institute, National Autonomous University of Mexico, Ciudad Universitaria, Mexico City, DF, Mexico.