Latest update: September 24, 2018


ProGT36 (PglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT36 (PglB)
ProGT Pathway
Organism Information
Organism NameCampylobacter jejuni (strain RM1221)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)195099
Genome Information
Gene BankCP000025
EMBLCP000025
Gene Information
Gene NamepglB
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDQ5HTX9
NCBI Ref SeqWP_011049884.1.
UniProtKB Sequence>sp|Q5HTX9|PGLB_CAMJR Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) GN=pglB PE=1 SV=1 MLKKEYLKNPYLVLFAMIILAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASVANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY QSAIIVILFALFALEQKRLNFMIIGILGSATLIFLILSGGVDPILYQLKFYIFRNDESAN LTQGFMYFNVNQTIQEVENVDFSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKSDILQAMMKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
EMBL CDSAAW35590.1.
Sequence length713 AA
Subcellular LocationMembrane (Integral component of membrane)
PDB ID 3AAG
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18.1087.
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Experimental_strategiesIn vitro 
Litrature
Year Of Validation2010 
Reference Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J., & Kohda, D. (2009). Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. Journal of Biological Chemistry, jbc-M109.

Authors Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J., & Kohda, D.
Research groupsDivision of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan.
Corresponding Author Kohda, D.
ContactsDivision of Structural Biology, Medical Institute of Bioregulation, Kyushu University, Maidashi 3-1-1, Higashi-ku, Fukuoka 812-8582, Japan.