Latest update: September 24, 2018


ProGT40 (PglB1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT40 (PglB1)
Organism Information
Organism NameHelicobacter pullorum NCTC 12824
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)552535
Genome Information
Gene Information
Gene NamepglB
Protein information
Protein NamePglB1 
UniProtKB/ SwissProt IDE1B265
UniProtKB Sequence>tr|E1B265|E1B265_9HELI PglB1 OS=Helicobacter pullorum NCTC 12824 GN=pglB1 PE=4 SV=1 MQNKNWLLIAVFVYLIAILLRFYYPFVLGEFEEYFYHNALLLNTNDGYFYAQGARDILAG VKSTFYSPTHEILSQISAFLALILPFSLEQIIFYMPGFFGSLIVFFVVFVSRDFGGIPSF LCGILSAISVSYYNRTMFGYYDTDMLVIVLAFGVGVVIVELMRKISFFGLVLLILLSGFG LVYYPSMRYIFVGYVGILTIFGIFDRNIRMVNGCLLSVLLGFLLFSTHFVFWLFLCFCGV MIKFIQRLDRRIFDFVYCLLLVIFCGILAFRVVPEIFASVYVAQDSKEIVGFGYASVMGT ISEVSKIDFWNFVYRISGNLLWFVLGSVGIILLFLKKREFWIFLPFLIMGFFGYFGGLRF TFYAVVVYALGIGYLLCFLLDIFKRKIKWAVIFGVVFVCGSVFPHLWHIKNYIIPPILEN SEAKALQEIPAKYGDYALAWWDYGYFVRYFARLNTFVDGGIHSGKQNYPISFVLSAKNQK QSYNMAKLTFNHIEFEDFAKSHQYSQSKALEALKGDIDCVGKRSEDLYIILPLRMVRIFS TIMQFSQPKGEINQGLLMVSKTKSKDKIIFQDNVFVDIKKGKVGILNQEISLNIAKMIDL KDSSKSLEFDKNSSLVVLMLGGGDYILCDKEYLETFYFRGMFLDNLDSNLFEKVLKNEKI AIYKLKQ
EMBL CDSADM36003.1
Sequence length667 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18 11923
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Pentasaccharide
Glycan Information
Glycan transferredPentasaccharide 
Method of Glycan IndentificationMALDI-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name Cj0114
ProGPdb ID ProGP219
Acceptor Substrate name FAM-ADQNAT
Litrature
Year Of Validation2010 
Reference Jervis, A.J., Langdon, R., Hitchen, P., Lawson, A.J., Wood, A., Fothergill, J.L., Morris, H.R., Dell, A., Wren, B. & Linton, D. (2010). Characterization of N-linked protein glycosylation in Helicobacter pullorum. Journal of bacteriology, 192(19), 5228-5236.

Authors Jervis, A.J., Langdon, R., Hitchen, P., Lawson, A.J., Wood, A., Fothergill, J.L., Morris, H.R., Dell, A., Wren, B. & Linton, D.
Research groupsFaculty of Life Sciences, Michael Smith Building, University of Manchester, Manchester M13 9PT, United Kingdom.
Corresponding Author Linton, D.
ContactsFaculty of Life Sciences, Michael Smith Building, University of Manchester, Manchester M13 9PT, United Kingdom.