Latest update: September 24, 2018


ProGT41 (NGT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT41 (NGT)
Organism Information
Organism NameActinobacillus pleuropneumoniae
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Pasteurellaceae
Order: Pasteurellales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)715
Genome Information
Gene BankCP022715.1
EMBLCP022715.1
Gene Information
Gene Nameappser1_17560
Protein information
Protein NameNGT 
UniProtKB/ SwissProt IDA0A223MD76
NCBI Ref SeqWP_005599032.1
UniProtKB Sequence>tr|A0A223MD76|A0A223MD76_ACTPL UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae OX=715 GN=CHY23_00708 PE=4 SV=1 MENENKPNVANFEAAVAAKDYEKACSELLLILSQLDSNFGGIQEIEFEYPAQLQDLEQEK IVYFCTRMATAITTLFSDPVLEISDLGVQRFLVYQRWLALIFASSPFVNADHILQTYNRE PNRKNSLEIHLDSSKSSLIKFCILYLPESNVNLNLDVMWNISPELCASLCFALQSPRFIG TSTAFNKRATILQWFPRHLDQLKNLNNIPSAISHDVYMHCSYDTSVNKHDVKRALNHVIR RHIESEYGWKDRDVAHIGYRNNKPVMVVLLEHFHSAHSIYRTHSTSMIAAREHFYLIGLG SPSVDQAGQEVFDEFHLVAGDNMKQKLEFIRSVCESNGAAIFYMPSIGMDMTTIFASNTR LAPIQAIALGHPATTHSDFIEYVIVEDDYVGSEECFSETLLRLPKDALPYVPSALAPEKV DYLLRENSEVVNIGIASTTMKLNPYFLEALKAIRDRAKVKVHFHFALGQSNGITHPYVER FIKSYLGDSATAHPHSPYHQYLRILHNCDMMVNPFPFGNTNGIIDMVTLGLVGVCKTGAE VHEHIDEGLFKRLGLPEWLIANTVDEYVERAVRLAENHQERLELRRYIIENNGLNTLFTG DPRPMGQVFLEKLNAFLKEN
EMBL CDSASU15484
Sequence length620 AA
Subcellular LocationCytoplasm
String228399.appser1_17560
PDB ID 3Q3E 3Q3H 3Q3I
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Acceptor specificity Sequon_1Asn-Xaa-Ser/Thr
Donor TypeNucleotide activated sugars (UDP and GDP linked hexose)
Donor SpecificityUDP-Glc and UDP-Gal ( UDP-Glc is preferred over UDP-Gal)
Glycan Information
Glycan transferredMonosaccharides (Glc and Gal) 
Method of Glycan IndentificationGlycoProfile III Fluorescent Glycoprotein Detection kit
Experimental_strategiesIn vitro and In vivo  
Acceptor Subtrate Information
Acceptor Substrate name HMW1ct
ProGPdb ID ProGP227
Litrature
Year Of Validation2010 
Reference Choi, K. J., Grass, S., Paek, S., Geme III, J. W. S., & Yeo, H. J. (2010). The Actinobacillus pleuropneumoniae HMW1C-like glycosyltransferase mediates N-linked glycosylation of the Haemophilus influenzae HMW1 adhesin. PLoS One, 5(12), e15888.

Authors Choi, K. J., Grass, S., Paek, S., Geme III, J. W. S., & Yeo, H. J.
Research groupsDepartment of Biology and Biochemistry, University of Houston, Houston, Texas, United States of America.
Corresponding Author Yeo, H. J.
ContactsDepartment of Biology and Biochemistry, University of Houston, Houston, Texas, United States of America
Reference Kawai, F., Grass, S., Kim, Y., Choi, K. J., St Geme, J. W., & Yeo, H. J. (2011). Structural insights into the glycosyltransferase activity of the Actinobacillus pleuropneumoniae HMW1C-like protein. Journal of Biological Chemistry, jbc-M111.

Authors Kawai, F., Grass, S., Kim, Y., Choi, K. J., St Geme, J. W., & Yeo, H. J.
Research groupsDept. of Biology and Biochemistry, University of Houston, Houston, Texas 77204. Tel.: 713-743-8377; Fax: 713-743-8351
Corresponding Author Yeo, H. J.
ContactsDepartment of Biology and Biochemistry, University of Houston, Houston, Texas 77204.
Reference Song, Q., Wu, Z., Fan, Y., Song, W., Zhang, P., Wang, L., ... & Cheng, J. (2017). Production of homogeneous glycoprotein with multisite modifications by an engineered N-glycosyltransferase mutant. Journal of Biological Chemistry, 292(21), 8856-8863.

Authors Song, Q., Wu, Z., Fan, Y., Song, W., Zhang, P., Wang, L., ... & Cheng, J.
Research groupsState Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China and Department of Chemistry, Georgia State University, Atlanta, Georgia 30303
Corresponding Author Cheng, J.
ContactsState Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China
Reference Lomino, J. V., Naegeli, A., Orwenyo, J., Amin, M. N., Aebi, M., & Wang, L. X. (2013). A two-step enzymatic glycosylation of polypeptides with complex N-glycans. Bioorganic & medicinal chemistry, 21(8), 2262-2270.

Authors Lomino, J. V., Naegeli, A., Orwenyo, J., Amin, M. N., Aebi, M., & Wang, L. X.
Research groupsInstitute of Human Virology and Department of Biochemistry and Molecular Biology, University of Maryland School of Medicine, Baltimore, MD 21201, United States Institute of Microbiology, Dept. of Biology, ETH Zürich, Wolfgang-Pauli-Str. 10, 8093 Zürich, Switzerland
Corresponding Author Wang, L. X.
ContactsInstitute of Human Virology and Department of Biochemistry and Molecular Biology, University of Maryland School of Medicine, Baltimore, MD 21201, United States
Reference Xu, Y., Wu, Z., Zhang, P., Zhu, H., Zhu, H., Song, Q., ... & Cheng, J. (2017). A novel enzymatic method for synthesis of glycopeptides carrying natural eukaryotic N-glycans. Chemical Communications, 53(65), 9075-9077.

Authors Xu, Y., Wu, Z., Zhang, P., Zhu, H., Zhu, H., Song, Q., ... & Cheng, J.
Research groupsState Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, P. R. China Department of Chemistry, Georgia State University, Atlanta, Georgia 30303, USA
Corresponding Author Cheng, J.
ContactsState Key Laboratory of Medicinal Chemical Biology and College of Pharmacy, Nankai University, Haihe Education Park, 38 Tongyan Road, Tianjin 300353, China