Latest update: September 24, 2018


ProGT43 (NGT)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT43 (NGT)
Organism Information
Organism NameActinobacillus pleuropneumoniae serotype 5b (strain L20)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Pasteurellaceae
Order: Pasteurellales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)416269
Genome Information
Gene BankCP000569.1
EMBLCP000569.1
Gene Information
Gene NameAPL_1635
NCBI Gene ID4849812
Protein information
Protein NameNGT 
UniProtKB/ SwissProt IDA3N2T3
NCBI Ref SeqWP_005605627.1
UniProtKB Sequence>sp|A3N2T3|NGT_ACTP2 UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=APL_1635 PE=1 SV=1 MENENKPNVANFEAAVAAKDYEKACSELLLILSQLDSNFGGIHEIEFEYPAQLQDLEQEK IVYFCTRMATAITTLFSDPVLEISDLGVQRFLVYQRWLALIFASSPFVNADHILQTYNRE PNRKNSLEIHLDSSKSSLIKFCILYLPESNVNLNLDVMWNISPELCASLCFALQSPRFVG TSTAFNKRATILQWFPRHLDQLKNLNNIPSAISHDVYMHCSYDTSVNKHDVKRALNHVIR RHIESEYGWKDRDVAHIGYRNNKPVMVVLLEHFHSAHSIYRTHSTSMIAAREHFYLIGLG SPSVDQAGQEVFDEFHLVAGDNMKQKLEFIRSVCESNGAAIFYMPSIGMDMTTIFASNTR LAPIQAIALGHPATTHSDFIEYVIVEDDYVGSEECFSETLLRLPKDALPYVPSALAPEKV DYLLRENPEVVNIGIASTTMKLNPYFLEALKAIRDRAKVKVHFHFALGQSNGITHPYVER FIKSYLGDSATAHPHSPYHQYLRILHNCDMMVNPFPFGNTNGIIDMVTLGLVGVCKTGAE VHEHIDEGLFKRLGLPEWLIANTVDEYVERAVRLAENHQERLELRRYIIENNGLNTLFTG DPRPMGQVFLEKLNAFLKEN
EMBL CDSABN74719.1
Sequence length620 AA
Subcellular LocationCytoplasm
String416269.APL_1635.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Acceptor specificity Sequon_1NX(S/T)
Donor TypeNucleotide activated sugars (UDP and GDP linked hexose)
Donor SpecificityUDP-Glc and UDP-Gal ( UDP-Glc is preferred over UDP-Gal)
Glycan Information
Glycan transferredMonosaccharides (Glc and Gal) 
Experimental_strategiesIn vitro 
Acceptor Subtrate Information
Acceptor Substrate name Hexapeptide DANYTK (labeled with TAMRA at the N terminus)
Litrature
Year Of Validation2011 
Reference Schwarz, F., Fan, Y. Y., Schubert, M., & Aebi, M. (2011). Cytoplasmic N-glycosyltransferase of Actinobacillus pleuropneumoniae is an inverting enzyme and recognizes the NXS/T consensus sequence. Journal of Biological Chemistry, jbc-M111.

Authors Schwarz, F., Fan, Y. Y., Schubert, M., & Aebi, M.
Research groupsMolecular Biology and Biophysics, Department of Biology, ETH Zürich, 8093 Zürich, Switzerland
Corresponding Author Aebi, M.
ContactsMolecular Biology and Biophysics, Department of Biology, ETH Zürich, 8093 Zürich, Switzerland Inst. of Microbiology, Dept. of Biology, ETH Zürich, Wolfgang-Pauli-Str. 10, 8093 Zürich, Switzerland