Latest update: September 24, 2018


ProGT45 (TpeL)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT45 (TpeL)
Organism Information
Organism NameClostridium perfringens
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)1502
Genome Information
Gene Information
Gene NametpeL
NCBI Reference SequenceAB262081
Protein information
Protein NameTpeL 
UniProtKB/ SwissProt IDA2PYQ6
UniProtKB Sequence>tr|A2PYQ6|A2PYQ6_CLOPF TpeL OS=Clostridium perfringens GN=tpeL PE=4 SV=1 MGLMSKEQLIILAKNSSPKEGEYKKILELLDEYNLLNNSVEKNSIDLYLKLNELSKSIDI YLKKYKNSKRNNALYQLKSDLTKEVIEIKDTNLKPLEKNIHFVWVGGMINNISIDYINQW KDINSDYETIIWYDSEALLVNILKKAIIDSSNKEVLTKYESVLNDNSFDSNKFYRERMEV IFRKQKEFNNYYNTNDNYTKSLNDVIKVYLIEKYLKTDEELEKYINESKEVFKANGAKDI REYDILDDVELKSIYEQELLMRFNLASASDIIRVIVLNKLGGIYLDVDVLPGIKKHIFKD INKPTNISENKWQMIQLETIMKYKQYIKGYTENSFKNLPSDLQEMLQEKVVEKNLKSDIF QRLGDIFISELDTKIAFMFGKIANQVLISKKNSYSLNLIINQIKNRYNIINKCLSSAIEK GSNFNNTVDIFIQQLNEFYVNEGFFVSKVMGYLGDGYMPDMRATLNISGPGIYTAAYYDL LYFNERSLNPQILQEDLKYFEVPQALISQQTEQEINSSWTFNQVKSQIEYKKLVEKYTNK SLSENDKLNFNENKIIDKVELLNRINSNNLINFDDKEYLRYIIQLQGDKVSYEAAINLFI KNPSNSILVQEINNISYYFNSEYKSIDSIQFDNIPEILKGKNKIKLTFIGHGEEEFNTER FASLTVKEFSKKIYKVLDMIKSNTNVKEIQIDLLGCNMFSYNINVEETYPGKLLKVVLDY VDKIYNADIKPEIKISANQYEVRINKDGKKELLSHSGEWLSKEEAIIKDIASKEIIYFDT RENTIKAEAKNIMELITFRNSLDKKLNDLESLINNNFIVNEVYEQLTSNNLYRTSFRNSF LDTINFIEDVSQELYEIKIKNNINDDYIMALDEIKQDNNISEIKFININSGEFRVVRENS RLINKFKEDFKFMINNIKRLIKFSDNNKLITSFELKNIESSSGVSTLNTSFLIQSMIDYK AQNFDFNKLSTSVKVQIYCQITNISLSEIQDASNLVKIIAEANEIEINLIPTLANAIPLI TTIVDGINLIANIDELINTKDELLRKELAARIGIISSNMTAAISSYILYFTEFGEVFNPL LVPIAGISSGIPTLVNNILILEEKSKEITEYFSHISKVESDGLFKVSDNNSILIPLDDIA ISKIDFNKREVILDKLDIWAMEGGSGLSGKETFFSAPYINENLPKLSIDNLLKIDINKID FSIKGMMLPNGVSKTLGYEFNTVANIYELENDGVNLLNRIRDNYPGQFYWRYYATLFNYG MVNLKINYHDTDVKINLDNVDRMFIVPTLTIDQAREKLSYNFNGAGANYYIYLSSQPIKI FINGTKEDNWILNIDDIVKEVTIVNNSIVRGKFIENIFKKLTIEDNKIIIGNQKIYLKNN KTNIHFSVSILDGVNLMVEVDFNNKMYHLSLQGNEKTICNNMNIIQNNINKLFGSSNIKS IPYFYKNNGLENCIGVFSIKNNEFIYMLKYDDKNKIYKYKDNNLVCGFNLFDISYVDIIS NGDKNYLKGIWNTSVNNSEYKIEFLVELIDQNTIEIIKLNLSDGLIKSFLTILDNLESLD VKISTIYDFLKNILFRDVFLENESLNFIVSKGFVLTGNNSKNKYEFICNSENIQLYITEL YTNGTKFRNWLDNGKILVSSTGESSNNLIDI
EMBL CDSBAF46125.1
Sequence length1651 AA
Subcellular LocationHost cell plasma membrane
Function in Native Organism 1) It is a secretory glycosyltransferase which glycosylates the Rho family protein of host.
Additional Information1) TpeL is a glycosyltransferase uses UDP-GlcNAc and UDP-Glc as donor co-substrates and Rac and Ras subfamily protein as acceptor substrates.
Glycosyltransferase Information
Glycosylation TypeO- (Thr) linked 
CAZY FamilyGT44
EC Number (BRENDA)2.4.99.18.11923
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-Glc and UDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharides (Glc and GlcNAc) 
Method of Glycan IndentificationMS and MS/MS and MALDI TOF/TOF
Experimental_strategiesIn vitro 
Acceptor Subtrate Information
Acceptor Substrate name Ras (cH-Ras, N-Ras, and K-Ras)
Acceptor Substrate name RalA
Acceptor Substrate name Rap1B
Acceptor Substrate name Rac1
Litrature
Year Of Validation2010 
Reference Nagahama, M., Ohkubo, A., Oda, M., Kobayashi, K., Amimoto, K., Miyamoto, K., & Sakurai, J. (2011). Clostridium perfringens TpeL glycosylates the Rac and Ras subfamily proteins. Infection and immunity, 79(2), 905-910.

Authors Nagahama, M., Ohkubo, A., Oda, M., Kobayashi, K., Amimoto, K., Miyamoto, K., & Sakurai, J.
Research groupsDepartment of Microbiology, Faculty of Pharmaceutical Sciences, Tokushima Bunri University, Yamashiro-cho, Tokushima 770-8514, Japan
Corresponding Author Sakurai, J.
ContactsDepartment of Microbiology, Faculty of Pharmaceutical Sciences, Tokushima Bunri University, Yamashiro-cho, Tokushima 770-8514, Japan
Reference Guttenberg, G., Hornei, S., Jank, T., Schwan, C., Lü, W., Einsle, O., Papatheodorou, P. & Aktories, K. (2012). Molecular characteristics of Clostridium perfringens TpeL toxin and consequences of mono-O-GlcNAcylation of Ras in living cells. Journal of Biological Chemistry, jbc-M112.

Authors Guttenberg, G., Hornei, S., Jank, T., Schwan, C., Lü, W., Einsle, O., Papatheodorou, P. & Aktories, K.
Research groupsInstitute of Experimental and Clinical Pharmacology and Toxicology
Corresponding Author Aktories, K.
ContactsInstitute of Experimental and Clinical Pharmacology and Toxicology
Reference Pauillac, S., Dallayer, J., Lenormand, P., Rousselle, J. C., Bouvet, P., & Popoff, M. R. (2013). Characterization of the enzymatic activity of Clostridium perfringens TpeL. Toxicon, 75, 136-143.

Authors Pauillac, S., Dallayer, J., Lenormand, P., Rousselle, J. C., Bouvet, P., & Popoff, M. R.
Research groups Institut Pasteur, Anaerobic Bacteria and Toxins Unit, 25 rue du Dr Roux, 75724 Paris Cedex 15, France.
Corresponding Author Popoff, M. R.
ContactsInstitut Pasteur, Anaerobic Bacteria and Toxins Unit, 25 rue du Dr Roux, 75724 Paris Cedex 15, France.