Latest update: September 24, 2018


ProGT47 (ClPglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT47 (ClPglB)
Organism Information
Organism NameCampylobacter lari ATCC BAA-1060D
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)306263
Genome Information
Gene BankCP000932
EMBLCP000932
Gene Information
Gene NamepglB
NCBI Gene ID7410986
Protein information
Protein NameClPglB 
UniProtKB/ SwissProt IDB9KDD4
NCBI Ref SeqACM64573.1
UniProtKB Sequence>sp|B9KDD4|PGLB_CAMLR Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pglB PE=1 SV=1 MKLQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYAF AEGARDMIAGFHQPNDLSYFGSSLSTLTYWLYSILPFSFESIILYMSAFFASLIVVPIIL IAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVLVLPMLILLTFIRLTINKDIF TLLLSPVFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLTIALMIIALSMLAW QYKLALIVLLFAIFAFKEEKINFYMIWALIFISILILHLSGGLDPVLYQLKFYVFKASDV QNLKDAAFMYFNVNETIMEVNTIDPEVFMQRISSSVLVFILSFIGFILLCKDHKSMLLAL PMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLEKKQIKLSLRNKNILLILIAF FSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRYYSDVKTLI DGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMVKDYNKTSAK DFLESLNDKDFKFDTNKTRDVYIYMPYRMLRIMPVVAQFANTNPDNGEQEKSLFFSQANA IAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDIESITNGKFYYNEIDSKAQIY LLFLREYKSFVILDESLYNSSYIQMFLLNQYDQDLFEQITNDTRAKIYRLKR
EMBL CDSACM64573.1
Sequence length712 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Transfer the C.jejuni heptasaccharide to the peptide having the consensus sequence.
String306263.Cla_1253
PDB ID 3RCE
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.1.119
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS, and MALDI-TOF/TOF
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name scFv13-R4 EQNAT
Acceptor Substrate name TAMRA-GDQNATAF
Litrature
Year Of Validation2011 
Reference Lizak, C., Gerber, S., Numao, S., Aebi, M., & Locher, K. P. (2011). X-ray structure of a bacterial oligosaccharyltransferase. Nature, 474(7351), 350.

Authors Lizak, C., Gerber, S., Numao, S., Aebi, M., & Locher, K. P.
Research groupsInstitute of Microbiology, Department of Biology, ETH Zurich, CH-8093 Zurich, Switzerland
Corresponding Author Locher, K. P.
ContactsInstitute of Microbiology, Department of Biology, ETH Zurich, CH-8093 Zurich, Switzerland.
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.