Latest update: September 24, 2018


ProGT48 (DdPglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT48 (DdPglB)
Organism Information
Organism NameDesulfovibrio desulfuricans strain G20
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Desulfovibrionaceae
Order: Desulfovibrionales
Class: Deltaproteobacteria or Deltabacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)207559
Genome Information
Gene BankCP000112
EMBLCP000112
Gene Information
Gene NameDde3699
Protein information
Protein NameDdPglB 
UniProtKB/ SwissProt IDQ30V04
NCBI Ref Seq ABB40492.1
UniProtKB Sequence>sp|B9KDD4|PGLB_CAMLR Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=pglB PE=1 SV=1 MKLQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYAF AEGARDMIAGFHQPNDLSYFGSSLSTLTYWLYSILPFSFESIILYMSAFFASLIVVPIIL IAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVLVLPMLILLTFIRLTINKDIF TLLLSPVFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLTIALMIIALSMLAW QYKLALIVLLFAIFAFKEEKINFYMIWALIFISILILHLSGGLDPVLYQLKFYVFKASDV QNLKDAAFMYFNVNETIMEVNTIDPEVFMQRISSSVLVFILSFIGFILLCKDHKSMLLAL PMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLEKKQIKLSLRNKNILLILIAF FSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRYYSDVKTLI DGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMVKDYNKTSAK DFLESLNDKDFKFDTNKTRDVYIYMPYRMLRIMPVVAQFANTNPDNGEQEKSLFFSQANA IAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDIESITNGKFYYNEIDSKAQIY LLFLREYKSFVILDESLYNSSYIQMFLLNQYDQDLFEQITNDTRAKIYRLKR
EMBL CDSABB40492.1
Sequence length722 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Transfer the C.jejuni heptasaccharide to the Acceptor protein AcrA in E.coli.
Additional Information1) DdPglB does not follow -2 rule, negatively charged residue at the ?2 position of the glycosylation sequon N-X-S/T.
2) PglBDd has relaxed glycan specificity, It can transfer monosaccharide and polysaccharide to AcrA in E. coli apart from C. jejuni heptasaccharide.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.19.13108
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide (GalNAc- 1,4-GalNAc- 1,4-(Glc 1,3)-Gal-NAc- 1,4- GalNAc- 1,4-GalNAc- 1,3-Bac), where Bac is bacillosamine(2,4-diacetamido-2,4,6-trideoxyglucose). 
Method of Glycan IndentificationLC-MS, and MALDI-TOF/TOF
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name AcrA
ProGPdb ID ProGP217
Acceptor Substrate name scFv13-R4 AQNAT
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name scFv13-R4 QQNAT
Acceptor Substrate name scFv13-R4 CQNAT
Acceptor Substrate name scFv13-R4 EQNAT
Acceptor Substrate name scFv13-R4 FQNAT
Acceptor Substrate name scFv13-R4 GQNAT
Acceptor Substrate name scFv13-R4 HQNAT
Acceptor Substrate name scFv13-R4 LQNAT
Acceptor Substrate name scFv13-R4 MQNAT
Acceptor Substrate name scFv13-R4 NQNAT
Acceptor Substrate name scFv13-R4 PQNAT
Acceptor Substrate name scFv13-R4 SQNAT
Acceptor Substrate name scFv13-R4 TQNAT
Acceptor Substrate name scFv13-R4 YQNAT
Litrature
Year Of Validation2011 
Reference Ielmini, M. V., & Feldman, M. F. (2010). Desulfovibrio desulfuricans PglB homolog possesses oligosaccharyltransferase activity with relaxed glycan specificity and distinct protein acceptor sequence requirements. Glycobiology, 21(6), 734-742.

Authors Ielmini, M. V., & Feldman, M. F.
Research groupsAlberta Ingenuity Centre for Carbohydrate Science, Department of Biological Sciences, University of Alberta, Edmonton, Alta, Canada
Corresponding Author Feldman, M. F.
ContactsAlberta Ingenuity Centre for Carbohydrate Science, Department of Biological Sciences, University of Alberta, Edmonton, Alta, Canada
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.