Latest update: September 24, 2018


ProGT49 (PglA)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT49 (PglA)
Organism Information
Organism NameFrancisella tularensis SCHU S4
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Francisellaceae
Order: Thiotrichales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)177416
Genome Information
Gene BankAJ749949
EMBLCP010290
Gene Information
Gene NameFTT_0905
NCBI Gene ID3191692
NCBI Reference SequenceAJ749949.2
Protein information
Protein NamePglA 
UniProtKB/ SwissProt IDQ5NGE0
NCBI Ref SeqYP_169902.1
UniProtKB Sequence>tr|Q5NGE0|Q5NGE0_FRATT Type IV pili glycosylation protein OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=FTT_0905 PE=4 SV=1 MIEVINYLKKISYADYIFYFLTLAIFFVFLMPFMHYIVLNLIKVTSGSTVSYFNDTLAAN IYLFIDRYYIFYTVLGVASVAIFLNKRIFSEVIELFSSFNLSIRYAIALFFIFGVISSVF AISPSIAFKGVSVTFLQFFCILFIAVYIRDNSKAVRFFYTIILLSLIFFGGSLFLQLSLA NYSVYGSYIAGNIQKVLLYMYNCLNPRFLDNYFSWFMPLILLPWFVDLRPIYKLGSFIAL ILAWFILINHGFRTIFAEYIIILPLLYIFARRYFKIAFVVLVLALVYAGLLELFYNYFIA VVDHSNVKSSADLVRGGFSGRIPLWKEAFWVGVEHPLTGVGQWNYLAITKRPDGYPHNLL LEIWSQWGIPAFIAAAVVIITTVRNLYKKRLEICLNSYQCIFVMMLTAGMIDGMLNAMFK TSLGLFGCVFVFGFCLSIFVKQPQQDTSVSATSYAIVGLSIFASIFCIAILPLIFPPLWI
EMBL CDSAJI68644.1
Sequence length480 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Transfer the pentasaccharide into the native substrate PilA.
String177416.FTT_0905
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Donor SpecificityLipid linked glycan
Glycan Information
Glycan transferredPentasaccharide (HexNac-Hex-Hex-HexNac-HexNac) 
Method of Glycan IndentificationMS/MS (CID) , MS ETD
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name PliA
ProGPdb ID ProGP250
Litrature
Year Of Validation2011 
Reference Egge-Jacobsen, W., Salomonsson, E.N., Aas, F.E., Forslund, A.L., Winther-Larsen, H.C., Maier, J., Macellaro, A., Kuoppa, K., Oyston, P.C.F., Titball, R.W. & Thomas, R. M. (2011). O-linked glycosylation of the PilA pilin protein of Francisella tularensis: identification of the endogenous protein-targeting oligosaccharyltransferase and characterization of the native oligosaccharide. Journal of bacteriology, JB-00383.

Authors Egge-Jacobsen, W., Salomonsson, E.N., Aas, F.E., Forslund, A.L., Winther-Larsen, H.C., Maier, J., Macellaro, A., Kuoppa, K., Oyston, P.C.F., Titball, R.W. & Thomas, R. M.
Research groupsDepartment of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway
Corresponding Author Thomas, R. M.
ContactsDepartment of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway