Latest update: September 24, 2018


ProGT50 (PglA)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT50 (PglA)
Organism Information
Organism NameFrancisella tularensis FSC200
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Francisellaceae
Order: Thiotrichales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)351581
Genome Information
Gene BankCP009693
EMBLCP009693
Gene Information
Gene NamepglA
Protein information
Protein NamePglA 
UniProtKB/ SwissProt IDA0A0B6E216
NCBI Ref SeqWP_003017861.1
UniProtKB Sequence>tr|A0A0B6E216|A0A0B6E216_FRATU O-Antigen ligase family protein OS=Francisella tularensis subsp. holarctica OX=119857 GN=BPP09_06905 PE=4 SV=1 MIEVINYLKKISYADYIFYFLTLAIFFVFLMPFMHYTVLNLVKVTSGSTVSYFNDTLAAN IYLFIDRYYIFYTVLGVASVAIFLNKRIFSEVIELFSSFNLSIRYAIALFFIFGVISSVF AISPSIAFKGVSVTFLQFFCILFIAVYIRDNSKAVRFFYTIILLSLIFFGGSLFLQLSLA NYSVYGSYIAGNIQKVLLYMYNCLNPRFLDNYFSWFMPLLLLPWFVDLRPIYKLGSFIAL ILAWFILINHGFRTIFAEYIIILPLLYIFARRYFKIAFVVLVLALVCAGLLELFYNYFIA VVDHSNVKSSADLVRGGFSGRIPLWKEAFWVGVEYPLTGVGQWNYLAITKRPDGYPHNLL LEIWSQWGIPAFIAAAVVIITTVRNLYKKRLEICLNPYQCIFVMMLTAGMIDGMLNAMFK TSLGLFGCVFVFGFCLSIFVKQPQQDTSVSATSYAIVGLSIFASIFCIAILPLIFPPLWI
EMBL CDSAJI51729.1
Sequence length480 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Transfer the pentasaccharide into the native substrate PilA.
String376619.FTL_0425
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Donor SpecificityLipid linked glycan
Glycan Information
Glycan transferredPentasaccharide (HexNac-Hex-Hex-HexNac-HexNac) 
Method of Glycan IndentificationMS/MS (CID) , MS ETD
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name PliA
ProGPdb ID ProGP250
Litrature
Year Of Validation2011 
Reference Egge-Jacobsen, W., Salomonsson, E.N., Aas, F.E., Forslund, A.L., Winther-Larsen, H.C., Maier, J., Macellaro, A., Kuoppa, K., Oyston, P.C.F., Titball, R.W. & Thomas, R. M. (2011). O-linked glycosylation of the PilA pilin protein of Francisella tularensis: identification of the endogenous protein-targeting oligosaccharyltransferase and characterization of the native oligosaccharide. Journal of bacteriology, JB-00383.

Authors Egge-Jacobsen, W., Salomonsson, E.N., Aas, F.E., Forslund, A.L., Winther-Larsen, H.C., Maier, J., Macellaro, A., Kuoppa, K., Oyston, P.C.F., Titball, R.W. & Thomas, R. M.
Research groupsDepartment of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway
Corresponding Author Thomas, R. M.
ContactsDepartment of Molecular Biosciences, University of Oslo, 0316 Oslo, Norway