Latest update: September 24, 2018


ProGT54 (Maf1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT54 (Maf1)
Organism Information
Organism NameAeromonas caviae Sch3N
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Aeromonadaceae
Order: Aeromonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)648?
Genome Information
Gene Information
Gene Namemaf1
NCBI Reference SequenceAEZ56237.1
Protein information
Protein NameMaf1 
UniProtKB/ SwissProt IDH6WL43
UniProtKB Sequence>tr|H6WL43|H6WL43_AERCA Putative flagellin pseudaminyl-transferase OS=Aeromonas caviae GN=maf1 PE=4 SV=1 MSLNIDVALSKAEHGAQRLQQQAEQEAAMAIALPLRFEQNMGAFRQYIPNIADIYEAYQP TRPFKIFCTENGQPNLMWVDESVAVYGAEPYLICETLAKEFIEKGALSKLSFSQETNPLG FMHVEYLNKLNIYLDEICENETLLGYVPSEVPSALVFGVGLGYHLGYLYERCKIGTLFLF EPDLDLFYASLYCFDWAPLLDYLHQENLGVHILLGQDEQTIVKDFSSAIHRRGSFLAANS FIMWGYQNDKIRALIEKVQQEYYLLVMGWGFFDDNLIALSHSITNIERSVPFLRKGEKIS SKYQRAPVFVIGNGPSLDEALDVIKEHKDNAILVACGSAISALHKIGIKPDIYVATERTK IVYDFLLNLNDPEYLHDIIFLSTDVIHPDCSTLFKQSALIFKAGEPGSSVYQTNFPTLPH YAVIGGVNPLVGNIGVSAPIYLGFTNLYLFGLDNGYKNKGHHHSRYSSYYNNEDNAKALG NLMYSDKQWSREGNFGGEIISNIMFDTSRRVVEQVLSTNENVQCFNCSDGVKIEGAKALP ASEVKLFHPINKHIILDEITRLFSPIPLSKQNFEPFIDVDYFNYFVDKMMGEWQEVFSSR NQINQLMLRNFNYLSQISSTNQRHISQVMIGSMNYVFTLLSTILYSIEDEDKALHFMKPA IDLWLEFLAEAKKMYPRALDSVDMIDNEVIVLFKK
EMBL CDSAEZ56237.1
Sequence length695 AA
Function in Native Organism 1) Aeromonas caviae Sch3N maf1 is a putative flagellin pseudaminyl transferase and essential in glycosylation of flagellar protein which helps in swarming motility of bacteria.
Additional Information1) Overexpression of Maf1 inhibits motility, indicating its a dominant negative effect, possibly caused by high amounts of glycosylated flagellin inhibit assembly of the flagellum.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Donor SpecificityCMP-Pse5Ac7Ac
Accessory GT IDProGT54.1 ProGT54.2 ProGT54.3 ProGT54.4 ProGT54.5
Glycan Information
Glycan transferredPse5Ac7Ac 
Method of Glycan IndentificationLC-MS/MS
Acceptor Subtrate Information
Acceptor Substrate name FlaA
ProGPdb ID ProGP296
Acceptor Substrate name FlaB
ProGPdb ID ProGP297
Litrature
Year Of Validation2012 
Reference Parker, J. L., Day-Williams, M. J., Tomas, J. M., Stafford, G. P., & Shaw, J. G. (2012). Identification of a putative glycosyltransferase responsible for the transfer of pseudaminic acid onto the polar flagellin of Aeromonas caviae Sch3N. MicrobiologyOpen, 1(2), 149-160.

Authors Parker, J. L., Day-Williams, M. J., Tomas, J. M., Stafford, G. P., & Shaw, J. G.
Research groupsAcademic Unit of Immunology and Infectious Diseases, Department of Infection and Immunity, University of Sheffield Medical School, Sheffield, S10 2RX United Kingdom
Corresponding Author Shaw, J. G.
ContactsAcademic Unit of Immunology and Infectious Diseases, Department of Infection and Immunity, University of Sheffield Medical School, Sheffield, S10 2RX United Kingdom.
Reference Parker, J. L., Lowry, R. C., Couto, N. A., Wright, P. C., Stafford, G. P., & Shaw, J. G. (2014). Maf?dependent bacterial flagellin glycosylation occurs before chaperone binding and flagellar T3SS export. Molecular microbiology, 92(2), 258-272.

Authors Parker, J. L., Lowry, R. C., Couto, N. A., Wright, P. C., Stafford, G. P., & Shaw, J. G.
Research groupsDepartment of Infection and Immunity, University of Sheffield, Sheffield, S10?2RX, UK.
Corresponding Author Shaw, J. G.
ContactsDepartment of Infection and Immunity, University of Sheffield, Sheffield, S10?2RX, UK.