Latest update: September 24, 2018


ProGT56 (PglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT56 (PglB)
ProGT Pathway
Organism Information
Organism NameCampylobacter Jejuni JCM 2013
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)1236539
Genome Information
Gene BankAB872218
EMBLAB872218
Gene Information
Gene NamepglB
NCBI Reference SequenceAB872218
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDA0A060NG81
NCBI Ref SeqWP_002879052.1
UniProtKB Sequence>tr|A0A060NG81|A0A060NG81_CAMJU Putative oligosaccharyltransferase OS=Campylobacter jejuni subsp. jejuni OX=32022 GN=pglB PE=4 SV=1 MLKKEYLKNPYLVLFAMIVLAYVFSVFCRFYWVWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGSSLSALTYWLYKVTPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY QSAIIVILFALFALEQKRLNFMIIGILGSATLIFLILSGGVDPILYQLKFYIFRSDESAN LTQGFMYFNVNQTIQEVENVDFSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKSDILQAMMKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
EMBL CDSBAO79832.1
Sequence length713 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
EC Number (BRENDA)2.4.1.119
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Accessory GT IDProGT56.1 ProGT56.2 ProGT56.3 ProGT56.4 ProGT56.5 ProGT56.6 ProGT56.7 ProGT56.8 ProGT56.9 ProGT56.10
Glycan Information
Glycan transferredHeptasaccharide (GalNAca-GalNAca-(Hex-)HexNAc-HexNAc-HexNAcHexNAc)  
Method of Glycan IndentificationNanoLC-MS/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name CmeA
ProGPdb ID ProGP217
Litrature
Year Of Validation2014 
Reference Srichaisupakit, A., Ohashi, T., & Fujiyama, K. (2014). Identification of a protein glycosylation operon from Campylobacter jejuni JCM 2013 and its heterologous expression in Escherichia coli. Journal of bioscience and bioengineering, 118(3), 256-262.

Authors Srichaisupakit, A., Ohashi, T., & Fujiyama, K.
Research groupsInternational Center for Biotechnology, Osaka University, Suita, Osaka 565-0871, Japan.
Corresponding Author Fujiyama, K.
ContactsInternational Center for Biotechnology, Osaka University, Suita, Osaka 565-0871, Japan.