Latest update: September 24, 2018


ProGT57 (PglLVc)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT57 (PglLVc)
Organism Information
Organism NameVibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Vibrionaceae
Order: Vibrionales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)243277
Genome Information
Gene BankAE003852
EMBLAE003852
Gene Information
Gene NameVC0393
NCBI Gene ID2614990
NCBI Reference SequenceAE003852
Protein information
Protein NamePglLVc 
UniProtKB/ SwissProt IDQ9KUW6
NCBI Ref SeqNP_230047
UniProtKB Sequence>tr|Q9KUW6|Q9KUW6_VIBCH Uncharacterized protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0393 PE=4 SV=1 MNCMATLLLSGTRLEPHAPNLPLNKPFLFALAVVYLLAMHFFMPNPGGAGLALSFNTTVW IATSITLAIGLYQLANNQALRYSKLTIGLWLSCALLTLPITYSNADWFHTLGRLVGLWAG FTLFLVLQQFRFSNKHKQRLLWFILLGSVIEAVIGLIQYFWLEPGNPFGYDTEANRPYGI FQQPNVMASFLATGLVLSGYLLARQPEKYDSRWSKIGILYATPLLTAPLLVVLASRTGWL ASLLSIALVAPYLYRFASRRRFTLWLLAITLGICAGFTAMYGQGTSGFVANKADLESPRR FTFPQTIDMIIEKPFTGYGYGKFEAQYLLYTARQHQLNSSYPAGLASMDHPHNELLYWGV EGGLLPVMGILLAACFCALRIYAAKRGTRMAMLALFVPITLHAQLEYPFYHSAIHWITFI ILIYWVDQRVARYRLASFTTLTKSLLRITSLVLPIVTSLYMVTALHTNYVLTQFEKSQPL NPELLKNVTNPLVWQDRFDWDIYSTYLNIGLHEQKAELIQPYIDWSLQIIQHKPRPAFYS NLILAYQGLGDTSRAQQIRREAEFLFPNQDFSTVQYHPSIKVNSATSDAEVPSAATP
EMBL CDSAAF93566.1
Sequence length597 AA
Subcellular LocationMembrane (Integral component of membrane)
String243277.VC0393
Potential Application1) Bacterial OTases with relaxed substrate specificity function as useful tools for glycoengineering of novel glycoconjugates with promising applications in vaccinology and diagnostics.
Additional Information1) PglLVc has an OTases activity and is able to glycosylate proteins which are known substrates of PglL of Neisseria meningitidis, this indicates that it recognizes and glycosylate the same motif as PglL of N. meningitidis.
2) In E. coli it shows relaxed glycan and protein specificity.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Donor TypeLipid linked sugars
Glycan Information
Glycan transferredMonosaccharide, diNAcBac, and CjLLO. 
Method of Glycan IndentificationMALDI-MS and MS/MS and C-ESI-QTOF-MS/MS.
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name Type IV pilin subunit protein,
ProGPdb ID ProGP99
Acceptor Substrate name Laz (lipid-azurin)
ProGPdb ID ProGP305
Acceptor Substrate name DsbA1
ProGPdb ID ProGP303
Litrature
Year Of Validation2012 
Reference Gebhart, C., Ielmini, M. V., Reiz, B., Price, N. L., Aas, F. E., Koomey, M., & Feldman, M. F. (2012). Characterization of exogenous bacterial oligosaccharyltransferases in Escherichia coli reveals the potential for O-linked protein glycosylation in Vibrio cholerae and Burkholderia thailandensis. Glycobiology, 22(7), 962-974.

Authors Gebhart, C., Ielmini, M. V., Reiz, B., Price, N. L., Aas, F. E., Koomey, M., & Feldman, M. F.
Research groupsDepartment of Biological Sciences, University of Alberta, Edmonton, Canada
Corresponding Author Feldman, M. F.
ContactsDepartment of Biological Sciences, University of Alberta, Edmonton, Canada