Latest update: September 24, 2018


ProGT58 (TfpO)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT58 (TfpO)
Organism Information
Organism NamePseudomonas amygdali pv. tabaci (Pseudomonas syringae pv. tabaci 6605)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)322
Genome Information
Gene Information
Gene NametfpO
NCBI Reference SequenceL14775
Protein information
Protein NameTfpO 
UniProtKB/ SwissProt IDG5EJ36
UniProtKB Sequence>tr|G5EJ36|G5EJ36_PSEAJ Putative pilin glycosyltransferase OS=Pseudomonas amygdali pv. tabaci OX=322 GN=tfpO PE=4 SV=1 MIFFLYCCAVLIISSCFYDFSGHDYQRVAQFFIGLSSLFMLLKYSAKQLSFYTVSPQVKL FFFSVVVMGVVSSLMSHRPLWALAELSVLLLSCGISYAFALQRNFYGVRLDQLFMGFVVL ICSLKIIQFLGSAAAAFLSSAPILDTDLLLDGFSNKRFYGQFQTFTLPLLVLPLLLTSTR RSIKIGLFCLTSLWWMIAISGGTRGTWLGMGVAVALMFCLGHAGRRWSGWQLAAAMAGLL LFTLLFSVLPGLLGIEVSNFAGDRLTTSLSAREILWQQAWAMIKERPLLGFGPMHFADIW NAVAAHPHQAILQWACEWGIPSTLCVAGLALYGLSTTAVLVRKRALSLEPVDLMRLCLFA SLIGALTQSMVDGVIVMPYSQLWLAIIIGWLLALHEWQIAPRPASIALSRAWLLCLTLAT GMILYTIVRDVPDMDTRRQQFSEDFGGRYLPRFWMQGVIADPPAR
EMBL CDSBAL05074.1
Sequence length465 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) tfpO is required for pilin glycosylation in P. amygdali pv. tabaci 6605.
Additional Information1) Deletion of tfpO gene encoding TfpO shows a production of unglycosylated Pilin which indicates that it is required for pilin glycosylation.
2) TfpO mutant also shows a reduction in surface motility and virulence toward host tobacco plant which shows that pilin glycan plays an important role in bacterial motility and virulence.
Glycosyltransferase Information
EC Number (BRENDA)2.4.99.18
Glycan Information
Method of Glycan IndentificationLC-ESI-MS
Acceptor Subtrate Information
Acceptor Substrate name PilA
ProGPdb ID ProGP230
Litrature
Year Of Validation2012 
Reference Nguyen, L.C., Taguchi, F., Tran, Q.M., Naito, K., Yamamoto, M., OHNISHI?KAMEYAMA, M.A.Y.U.M.I., Ono, H., Yoshida, M., Chiku, K., Ishii, T. & Inagaki, Y. (2012). Type IV pilin is glycosylated in Pseudomonas syringae pv. tabaci 6605 and is required for surface motility and virulence. Molecular plant pathology, 13(7), 764-774.

Authors Nguyen, L. C., Taguchi, F., Tran, Q. M., Naito, K., Yamamoto, M., OHNISHI?KAMEYAMA, M. A. Y. U. M. I., ... & Inagaki, Y.
Research groupsGraduate School of Natural Science and Technology, Okayama University, Tsushima-naka 1-1-1, Kita-ku, Okayama 700-8530, Japan
Corresponding Author Inagaki, Y.
ContactsGraduate School of Natural Science and Technology, Okayama University, Tsushima-naka 1-1-1, Kita-ku, Okayama 700-8530, Japan