Latest update: September 24, 2018


ProGT59 (WsfB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT59 (WsfB)
Organism Information
Organism NamePaenibacillus alvei CCM 2051T
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)44250
Genome Information
Gene BankHM011508
EMBLHM011508
Gene Information
Gene NamewsfB
NCBI Reference SequenceADG29284.1
Protein information
Protein NameWsfB 
UniProtKB/ SwissProt IDD6QW55
UniProtKB Sequence>tr|D6QW55|D6QW55_PAEAL WsfB OS=Paenibacillus alvei GN=wsfB PE=4 SV=1 MADFDQPIYVAALFSSIIAMIAIAVGWKQFNWSSRKDILSLFVFLLPASFALSMITAASN YLAVNMLIIMLMYCIFFVASSIIAQDSVVNRTLNLAIMIISYIVVFFGLFHWLGNGPGVT TLIKWLGISTTPSGAYLNAVMSDSNGERLASVFQYANTYAGFLMAFLLGALFFISKSQKW WGKSGHAFMIVPIMLSIFLTLSRGGLLLLPVAFIVVLVFLKPYRQLMWIMHLAVSGVITV LILNPVTDIGLQVQKEFAASNSFKGWAYIIISSLIAAAISYALERWVSPWLEQKTTAISN KRWGTFLIPVGGAVLGALLLFVLIGTNIKNMLPENISTRLETINLQQHSVLERITFYKDS MKLIADYPFIGAGGGAWAALYAKYENNPYDVQQAHSFYMQYLVETGVIGMLILIAFLIYI YWNYIRTFINTTDEKRDDHFLFFILATSILIHSAMDFNMSFVYIGILVFLCLGGMTASID SKPLDKVKSKAMRTVFASIFGIVSIGLFITSILFVQASSSFASAKETVLTTQDFTKTMVQ LRKAKSIRSTHPEYAAFEANLYMSVYQQQKDEQFYAEAEKVLKNALGDNPHNKSLLLQLI KLYNIKGLDEQVYTVYSQNASNFPWDMKWYAEYMDKASLEGYKAISTAPDKKDGYLNEVI AAFEHVKASVEHLKTLPKGQLQGNPFYVTSSMAMNAGRAYLMKGDPAKAAEAMKPYLQED LTNSNDPENSPENNRELARWYVAATIQQGQVDQNWYDKLVALGSDQKEQIDQIAGMRFKA E
EMBL CDSADG29284.1.
Sequence length781 AA
Subcellular LocationMembrane (Integral component of membrane)
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Accessory GT IDProGT59.1 ProGT59.2 ProGT59.3 ProGT59.4 ProGT59.5 ProGT59.6 ProGT59.7 ProGT59.8 ProGT59.9 ProGT59.10 ProGT59.11 ProGT59.12 ProGT59.13 ProGT59.14 ProGT59.15 ProGT59.16
Glycan Information
Glycan transferredL-Rha-alpha1,3-D-Gal 
Method of Glycan IndentificationLC-ESI-MS/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name SpaA
ProGPdb ID ProGP75
Litrature
Year Of Validation2012 
Reference Ristl, R., Janesch, B., Anzengruber, J., Forsthuber, A., Blaha, J., Messner, P., & Schäffer, C. (2012). Description of a putative oligosaccharyl: S-layer protein transferase from the tyrosine O-glycosylation system of Paenibacillus alvei CCM 2051T. Advances in microbiology, 2(4), 537.

Authors Ristl, R., Janesch, B., Anzengruber, J., Forsthuber, A., Blaha, J., Messner, P., & Schäffer, C.
Research groupsDepartment of NanoBiotechnology, NanoGlycobiology Unit, University of Natural Resources and Applied Life Sciences, Vienna, Vienna, Austria
Corresponding Author Schäffer, C.
ContactsDepartment of NanoBiotechnology, NanoGlycobiology Unit, University of Natural Resources and Applied Life Sciences, Vienna, Vienna, Austria