Latest update: September 24, 2018


ProGT6 (TcsL 82)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT6 (TcsL 82)
Organism Information
Organism NameClostridium sordellii IP82
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)1505
Genome Information
Gene Information
Gene NametcsL
NCBI Reference SequenceKF726114.1
Protein information
Protein NameTcsL 82 
UniProtKB/ SwissProt IDV5T792
UniProtKB Sequence>tr|V5T792|V5T792_PAESO Cytotoxin L OS=Paeniclostridium sordellii OX=1505 GN=tcsL PE=4 SV=1 MSLVNKAQLQKMAYVKFRIQEDEYVAILNALEEYHNMSESSVVEKYLKLKDINNLTDNYL NTYKKSGRNKALKKFKEYLTMEVLELKNNSLTPVEKNLHFIWIGGQINDTAINYINQWKD VNSDYTVKVFYDSNAFLINTLKKTIVESATNNTLESFRENLNDPEFDYNKFYRKRMEIIY DKQKHFIDYYKSQIEENPEFIIDNIIKTYLSNEYSKDLEALNKYIEESLNKITANNGNDI RNLEKFADEDLVRLYNQELVERWNLAAASDILRISMLKEDGGVYLDVDMLPGIQPDLFKS INKPDSITNTSWEMIKLEAIMKYKEYIPGYTSKNFDMLDEEIQRSFESALSSKSDKSEIF LPLDDIKVSPLEVKIAFANNSVINQALISLKDSYCSDLVINQIKNRYKILNDNLNPSINE GTDFNTTMKIFSDKLASISNEDNMMFMIKITNYLKVGFAPDVRSTINLSGPGVYTGAYQD LLMFKDNSTNIHLLEPELRNFEFPKTKISQLTEQEITSLWSFNQARAKSQFEEYKKGYFE GALGEDDNLDFAQNTVLDKDYVSKKILSSMKTRNKEYIHYIVQLQGDKISYEASCNLFSK DPYSSILYQKNIEGSETAYYYSVADAEIKEIDKYRIPYKISNKHKIKLTFIGHGKSEFNT DTFANLDVDSLSSEIETILNLAKADISPKYIEINLLGCNMFSYSISAEETYPGKLLLKIK DRVSELMPSISQDSITVSANQYEVRINEEGKREILDHSGKWINKEESIIKDISSKEYISF NPKENKIIVKSKYLHELSTLLQEIRNNANSSDIDLEKKVMLTECEINVASNIDRQIVEGR IEEAKNLTSDSINYIKNEFKLIESISDSLYDLKHQNGLDDSHFISFEDISKTENGFRIRF INKETGNSIFIETEKEIFSEYAAHISKEISNIKDTIFDNVNGKLVKKVNLNAAHEVNTLN SAFFIQSLIEYNTTKESLSNLSVAMKVQVYAQLFSTGLNTITDASKVVELVSTALDETID LLPTLSEGLPIIATIIDGVSLGAAIKELSETNDPLLRQEIEAKIGIMAVNLTAASTAIVT SALGIASGFSILLVPLAGISAGIPSLVNNELILQDKATKVIDYFKHISLAETEGAFTLLD DKIIMPQDDLVLSEIDFNNNSITLGKCEIWRAEGGSGHTLTDDIDHFFSSPSITYRKPWL SIYDVLNIKKEKIDFSKDLMVLPNAPNRVFGYEMGWTPGFRSLDNDGTKLLDRIRDHYEG QFYWRYFAFIADALITKLKPRYEDTNVRINLDGNTRSFIVPVITTEQIRKNLSYSFYGSG GSYSLSLSPYNMNIDLNLVENDTWVIDVDNVVKNITIESDEIQKGELIENILSKLNIEDN KIILNNHTINFYGDINESNRFISLTFSILEDINIIIEIDLVSKSYKILLSGNCMKLIENS SDIQQKIDHIGFNGEHQKYIPYSYIDNETKYNGFIDYSKKEGLFTAEFSNESIIRNIYMP DSNNLFIYSSKDLKDIRIINKGDVKLLIGNYFKDDMKVSLSFTIEDTNTIKLNGVYLDEN GVAQILKFMNNAKSALNTSNSLMNFLESINIKNIFYNNLDPNIEFILDTNFIISGSNSIG QFELICDKDKNIQPYFIKFKIKETSYTLYVGNRQNLIVEPSYHLDDSGNISSTVINFSQK YLYGIDRYVNKVIIAPNLYTDEINITPVYKPNYICPEVIILDANYINEKINVNINDLSIR YVWDNDGSDLILIANSEEDNQPQVKIRFVNVFKSDTAADKLSFNFSDKQDVSVSKIISTF SLAAYSDGFFDYEFGLVSLDNDYFYINSFGNMVSGLIYINDSLYYFKPPKNNLITGFTTI DGNKYYFDPTKSGAASIGEITIDGKDYYFNKQGILQVGVINTSDGLKYFAPAGTLDENLE GESVNFIGKLNIDGKIYYFEDNYRAAVEWKLLDDETYYFNPKTGEALKGLHQIGDNKYYF DDNGIMQTGFITINDKVFYFNNDGVMQVGYIEVNGKYFYFGKNGERQLGVFNTPDGFKFF GPKDDDLGTEEGELTLYNGILNFNGKIYFFDISNTAVVGWGTLDDGSTYYFDDNTAEACI GLTVINDCKYYFDDNGIRQLGFITINDNIFYFSESGKIELGYQNINGNYFYIDESGLVLI GVFDTPDGYKYFAPLNTVNDNIYGQAVKYSGLVRVNEDVYYFGETYKIETGWIENETDKY YFDPETKKAYKGINVVDDIKYYFDENGIMRTGLISFENNNYYFNEDGKMQFGYLNIKDKM FYFGKDGKMQIGVFNTPDGFKYFAHQNTLDENFEGESINYTGWLDLDGKRYYFTDEYIAA TGSLTIDGYNYYFDPDTAELVVSE
EMBL CDSAHB59891.1
Sequence length2364 AA
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-Glc and UDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharids (Glc and GlcNAc) 
Experimental_strategiesIn vitro 
Acceptor Subtrate Information
Acceptor Substrate name Rac1
Litrature
Year Of Validation1996 
Reference Hofmann, F., Rex, G., Aktories, K., & Just, I. (1996). The Ras-Related Protein Ral Is Monoglucosylated byClostridium sordelliiLethal Toxin. Biochemical and biophysical research communications, 227(1), 77-81.

Authors Hofmann, F., Rex, G., Aktories, K., & Just, I.
Research groupsInstitute of Pharmacology and Toxicology, Albert-Ludwigs-Universität Freiburg, Germany
Corresponding Author Just, I.
ContactsInstitute of Pharmacology and Toxicology, Albert-Ludwigs-Universität Freiburg, Germany
Reference Genth, H., Pauillac, S., Schelle, I., Bouvet, P., Bouchier, C., Varela?Chavez, C., Just, I. & Popoff, M. R. (2014). Haemorrhagic toxin and lethal toxin from C lostridium sordellii strain vpi9048: molecular characterization and comparative analysis of substrate specificity of the large clostridial glucosylating toxins. Cellular microbiology, 16(11), 1706-1721.

Authors Genth, H., Pauillac, S., Schelle, I., Bouvet, P., Bouchier, C., Varela?Chavez, C., Just, I. & Popoff, M. R.
Research groupsInstitute of Toxicology, Medical School Hannover, Hannover, Germany.
Corresponding Author Popoff, M. R.
ContactsInstitute of Toxicology, Medical School Hannover, Hannover, Germany.