Latest update: September 24, 2018


ProGT61 (Pmt)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT61 (Pmt)
ProGT Pathway
Organism Information
Organism NameMycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumActinobacteria
ClassificationFamily: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)246196
Genome Information
Gene BankCP000480
EMBLCP000480
Gene Information
Gene NameMSMEG_5447
NCBI Gene ID4533117
NCBI Reference SequenceCP000480
Protein information
Protein NamePmt 
UniProtKB/ SwissProt IDA0R3E8
NCBI Ref SeqWP_011730541.1
UniProtKB Sequence>tr|A0R3E8|A0R3E8_MYCS2 Dolichyl-phosphate-mannose-protein mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5447 PE=4 SV=1 MTALDTDTPTAGRSAPLISPGPVIPPPDFGPLDRAQGWAMTAIITALAAITRFLNLGSPT DAGTPIFDEKHYAPQAWQVLHNDGVEDNPGYGLVVHPPVGKQLIAIGEWLFGYNGLGWRF SGAVCGVIIVMLVTRIARRISRSTLVGAIAGLLIIADGVSFVSSRTALLDVFLVMFAVAA FACLMVDRDQVRERMYHAFLDGRIAETRWGTRLGVRWWRFGAGVLLGLACATKWSGLYFV LFFGVMTLVFDAIARKQYHVPHPWRGMLRRDLGPAAYVFGLIPFAVYLASYAPWFASETA VNRYEVGRSIGPDSILPIPDALRSLWHYTHAAYRFHSNLTNADGNHHPWESKPWTWPMSL RPVLYAIDNQDVPGCGAQSCVKAVMLVGTPAMWFIAVPVLGWALWRTVVRRDWRYGAVLV GYMAGFLPWFADIDRQMYFFYATVMAPFLVLAIALILGDILYKPNQNPERRTLGLLTVCF YVALVITNFAWMYPILTGLPISQTTWNLQIWLPSWR
EMBL CDSABK72177.1
Sequence length516 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Inactivation of the Msmeg_5447 gene interrupts the O-mannosylation of the M. smegmatis FasC protein.
String246196.MSMEG_5447
Additional Information1) Protein mannosylation in M. smegmatis occurs through a stepwise manner of transfer of mannose residue onto protein by the PMT encoded by Msmeg_5447 followed by the elongation of the mannosyl chain through alpha1-2 linkages by PimE.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT39
EC Number (BRENDA)2.4.1.-
Glycan Information
Glycan transferredMonosaccharide (Man) 
Method of Glycan IndentificationNano-LC-MS/MS and (ETD) MS/MS
Acceptor Subtrate Information
Acceptor Substrate name ABC-type amino acid transport system secreted component
ProGPdb ID ProGP459
Acceptor Substrate name Putative protein
ProGPdb ID ProGP460
Acceptor Substrate name Putative uncharacterized protein
ProGPdb ID ProGP461
Acceptor Substrate name Putative uncharacterized protein
ProGPdb ID ProGP462
Acceptor Substrate name Immunogenic protein MPT63
ProGPdb ID ProGP467
Acceptor Substrate name Putative protein
ProGPdb ID ProGP464
Acceptor Substrate name Immunogenic protein MPT63
ProGPdb ID ProGP461
Acceptor Substrate name Putative protein
ProGPdb ID ProGP466
Acceptor Substrate name Alanine and proline-rich secreted protein apa
ProGPdb ID ProGP467
Acceptor Substrate name FasC (fasciclin domain protein)
ProGPdb ID ProGP435
Litrature
Year Of Validation2013 
Reference Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O. (2013). Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences, 201219704.

Authors Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.
Research groups1 National Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
Corresponding Author Burlet-Schiltz, O.
ContactsNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.