Latest update: September 24, 2018


ProGT62 (PimE)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT62 (PimE)
Organism Information
Organism NameMycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumActinobacteria
ClassificationFamily: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)246196
Genome Information
Gene BankCP000480
EMBLCP000480
Gene Information
Gene NameMsmeg_5149
NCBI Reference SequenceNC_008596.1.
Protein information
Protein NamePimE 
UniProtKB/ SwissProt IDA0R2K8
NCBI Ref SeqYP_889686.1
UniProtKB Sequence>sp|A0R2K8|PIME_MYCS2 Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pimE PE=1 SV=2 MRVNGYRGAKVGAVDTTSPPEVPASARLQRLAPMLLVVSILARLAWTYLVPNGANFVDLH VYVGGADALDGPGALYDYVYADQTPDFPLPFTYPPFAAIVFYPLHLLPFGVVAFIWQIGI IAALYGVVRVSQRLMGLQSQRRVAMLWTALGIWTEPLRSTFDYGQVNVVLVLAVLCAVST TRWWLSGLLVGLAAGIKLTPAVAGLYFLGARRWAAVACSAAVFFATVGVSWLVVGAQARR YFTELLGDADRIGPIGTSFNQSWRGGISRILGHDAGFGPLVLIGIGITAVLALLAWRAIG GAQDRLGGILVVSLFGLVLSPISWTHHWVWLIPLMMWLLHGPLSALRGARILGWGWLALT LLGVPWLLSFAQPTIWEIGRPWYLAWAGLVYIVATLATLGWIAFSRKGSG
EMBL CDSABK75499.1
Sequence length410 AA
Subcellular LocationMembrane (Integral component of membrane)
Function in Native Organism 1) Inactivation of the M. tuberculosis Rv1002c gene impairs Apa protein O-mannosylation and the diminished ability of Mtb mutants to form colonies on solid medium.
String246196.MSMEG_5149
Additional Information1) Mutation in Rv1002c gene showed the essential role of O-mannosylation in virulence and growth.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT87
EC Number (BRENDA)2.4.1.-
Glycan Information
Glycan transferredMannosyl chain elongation through alpha1-2 linkages 
Method of Glycan IndentificationNano-LC-MS/MS and (ETD) MS/MS
Acceptor Subtrate Information
Acceptor Substrate name ABC-type amino acid transport system secreted component
ProGPdb ID ProGP459
Acceptor Substrate name Putative protein
ProGPdb ID ProGP460
Acceptor Substrate name Putative uncharacterized protein
ProGPdb ID ProGP461
Acceptor Substrate name Putative uncharacterized protein
ProGPdb ID ProGP462
Acceptor Substrate name Immunogenic protein MPT63
ProGPdb ID ProGP467
Acceptor Substrate name Putative protein
ProGPdb ID ProGP464
Acceptor Substrate name Immunogenic protein MPT63
ProGPdb ID ProGP461
Acceptor Substrate name Putative protein
ProGPdb ID ProGP466
Acceptor Substrate name Alanine and proline-rich secreted protein apa
ProGPdb ID ProGP467
Acceptor Substrate name FasC (fasciclin domain protein)
ProGPdb ID ProGP435
Litrature
Year Of Validation2013 
Reference Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O. (2013). Bacterial protein-O-mannosylating enzyme is crucial for virulence of Mycobacterium tuberculosis. Proceedings of the National Academy of Sciences, 201219704.

Authors Liu, C.F., Tonini, L., Malaga, W., Beau, M., Stella, A., Bouyssié, D., Jackson, M.C., Nigou, J., Puzo, G., Guilhot, C. & Burlet-Schiltz, O.
Research groupsNational Center Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.
Corresponding Author Burlet-Schiltz, O.
ContactsNational Center for Scientific Research, Institute of Pharmacology and Structural Biology, F-31077 Toulouse, France.