Latest update: September 24, 2018


ProGT63 (NleB1)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT63 (NleB1)
Organism Information
Organism NameEscherichia coli
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)574521
Genome Information
Gene BankFM180568
EMBLFM180568
Gene Information
Gene NamenleB1
NCBI Reference SequenceFM180568?
Protein information
Protein NameNleB1 
UniProtKB/ SwissProt IDB7UI21
NCBI Ref SeqWP_012578998.1
UniProtKB Sequence>tr|B7UI21|B7UI21_ECO27 T3SS secreted effector NleB homolog OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=E2348C_3231 PE=4 SV=1 MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKG EVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRA DVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKR EHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIA VHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSL HNYNAFCDFIEFKHENIIPNTSMYTSSSW
EMBL CDSCAS10779.1
Sequence length329 AA
Subcellular LocationHost cell plasma membrane
Additional Information1) NleB, N-acetylglucosamine (GlcNAc) transferase modify a conserved arginine in death domains proteins of the host such as TRADD and FADD.
2) NleB GlcNAcylation of death domains blocked homotypic/heterotypic death domain interactions and assembly of the oligomeric TNFR1 complex which results in disrupting TNF signaling in EPEC-infected cells, including NFkB signaling, apoptosis, and necroptosis.
3) The arginine GlcNAc transferase activity of NleB is required for bacterial colonization in the mouse model of EPEC infection.
Glycosyltransferase Information
Glycosylation TypeN- (Arg) linked  
CAZY FamilyGTNC
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationLC-MS, MALDI-TOF, MS (ETD)
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name TRADD
Acceptor Substrate name FADD 
Acceptor Substrate name SdrE
Litrature
Year Of Validation2013 
Reference Li, S., Zhang, L., Yao, Q., Li, L., Dong, N., Rong, J., Gao, W., Ding, X., Sun, L., Chen, X. & Chen, S. (2013). Pathogen blocks host death receptor signalling by arginine GlcNAcylation of death domains. Nature, 501(7466), 242.

Authors Li, S., Zhang, L., Yao, Q., Li, L., Dong, N., Rong, J., Gao, W., Ding, X., Sun, L., Chen, X. & Chen, S.
Research groupsCollege of Biological Sciences, China Agricultural University, Beijing 100094, China
Corresponding Author Chen, S.
ContactsCollege of Biological Sciences, China Agricultural University, Beijing 100094, China
Reference Pearson, J.S., Giogha, C., Ong, S.Y., Kennedy, C.L., Kelly, M., Robinson, K.S., Lung, T.W.F., Mansell, A., Riedmaier, P., Oates, C.V. & Zaid, A. (2013). A type III effector antagonizes death receptor signalling during bacterial gut infection. Nature, 501(7466), 247.

Authors Pearson, J.S., Giogha, C., Ong, S.Y., Kennedy, C.L., Kelly, M., Robinson, K.S., Lung, T.W.F., Mansell, A., Riedmaier, P., Oates, C.V. & Zaid, A.
Research groupsDepartment of Microbiology and Immunology, University of Melbourne, Victoria 3010, Australia
Corresponding Author Zaid, A.
ContactsDepartment of Microbiology and Immunology, University of Melbourne, Victoria 3010, Australia