Latest update: September 24, 2018


ProGT66 (SdgA)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT66 (SdgA)
Organism Information
Organism NameStaphylococcus aureus
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)367830
Genome Information
Gene BankCP000255
EMBLCP000255
Gene Information
Gene NameSAUSA300_0549
NCBI Reference SequenceABD21657
Protein information
Protein NameSdgA 
UniProtKB/ SwissProt IDA0A0H2XI10
NCBI Ref SeqWP_001106738.1
UniProtKB Sequence>tr|A0A0H2XI10|A0A0H2XI10_STAA3 Glycosyl transferase, group 1 family protein OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0549 PE=4 SV=1 MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYSYTYAKQHQIENDVFT MYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYDEEQFVMYAHFLDKQYH QLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENYYTPNGEIVIQKYFDDIK GKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIILDRPHELGNVIAGLNQSIP VIVVLHSTHLSGAGNGIKSFYKTVFNNLTRYKAIVVSTEKQCQDISQYIENKIPVINIPV GYVANLKYQFDINQKEKNHIISIARLVENKQIKHQIEVIKQLVTKHPNIQLNIYGHGNGL SEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVIS YDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNNTQKLQQFSINSIESAQQYNATT ISTKWQNILN
EMBL CDSABD21657.1
Sequence length490 AA
Function in Native Organism 1) SdgA sequentially transfers second GlcNAc residue on previously GlcNAcylated SDR protein.
Potential Application
Additional Information1) SdgA and SdgB GlcNAcylate staphylococcal SDR-proteins sequentially, this modification protects them against host proteolytic activity.
2) aggB (sdgA) and aggC (sdgB) are involved in GlcNAc modification of the ClfA SD repeats.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.109
Mechanism of Glycan TransferSequential
Acceptor specificity Sequon_1Serine-Aspartate dipeptide-Repeats (SDR)
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name Pls (Plasmin sensitive surface protein)
ProGPdb ID ProGP550
Acceptor Substrate name ClfASD5
Litrature
Year Of Validation2013 
Reference Hazenbos, W.L., Kajihara, K.K., Vandlen, R., Morisaki, J.H., Lehar, S.M., Kwakkenbos, M.J., Beaumont, T., Bakker, A.Q., Phung, Q., Swem, L.R. & Ramakrishnan, S. (2013). Novel staphylococcal glycosyltransferases SdgA and SdgB mediate immunogenicity and protection of virulence-associated cell wall proteins. PLoS pathogens, 9(10), e1003653.

Authors Hazenbos, W.L., Kajihara, K.K., Vandlen, R., Morisaki, J.H., Lehar, S.M., Kwakkenbos, M.J., Beaumont, T., Bakker, A.Q., Phung, Q., Swem, L.R. & Ramakrishnan, S.
Research groupsDept. of Infectious Diseases, Genentech, Inc., San Francisco, California, United States of America.
Corresponding Author Ramakrishnan, S.
ContactsDept. of Infectious Diseases, Genentech, Inc., San Francisco, California, United States of America
Reference Thomer, L., Becker, S., Emolo, C., Quach, A., Kim, H.K., Rauch, S., Anderson, M., LeBlanc, J.F., Schneewind, O., Faull, K.F. & Missiakas, D. (2013). N-acetylglucosaminylation of serine-aspartate repeat proteins promotes Staphylococcus aureus blood stream infection. Journal of Biological Chemistry, jbc-M113.

Authors Thomer, L., Becker, S., Emolo, C., Quach, A., Kim, H.K., Rauch, S., Anderson, M., LeBlanc, J.F., Schneewind, O., Faull, K.F. & Missiakas, D.
Research groupsDepartment of Microbiology, The University of Chicago, Chicago, Illinois 60637
Corresponding Author Missiakas, D.
ContactsDepartment of Microbiology, The University of Chicago, Chicago, Illinois 60637