Latest update: September 24, 2018


ProGT70 (GtfB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT70 (GtfB)
Organism Information
Organism NameLactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)220668
Genome Information
Gene BankAL935263
EMBLAL935263
Gene Information
Gene NametagE6 (lp_2844)
NCBI Gene ID1063214
Protein information
Protein NameGtfB 
UniProtKB/ SwissProt IDF9URU7
NCBI Ref SeqWP_003642121.1
UniProtKB Sequence>tr|F9URU7|F9URU7_LACPL Poly(Glycerol-phosphate) alpha-glucosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tagE6 PE=4 SV=1 MYYFVNTSINPKKSGIEHAEMKRLALFNQHHVPAKMVTRFFSLSLHQTLTAAGIAAENQI NLFDFIQHSSERPTTKMTIEDLHLAPDLRVQSVGRHYEVYQNDQLLMKVNTFLNTQKQLN NVQYYDQNGKLVKTDWYDTRGFKGLEQFYAADGQVASEQVFNPDGEVVYQTFHMADRQNQ VQNSLYRFINYEGQDWSFAGETAMTTFFLDELNRRTPHAVFVIDRTYELAYAALHMRTKA FKVMHLHSNHVNDPAHPKTASLNFNYAYALNNLDQWNGVIASTKQQTADFQARFGNQPAV YTIPVGIVDDATLNAPKPSFDQRTAGKIIFVARLAEEKQQDQVIRAFKKVLAQVPNATLD FWGYANGDTGKQLHQLVEQLGLKAAVTFNDYTTDLTAVYNDAQLAMLTSRAEGFALALLE GQAHGVPQIAYDVKYGPRDIIRDGHDGQLVPVNDENALATAMIDLLTQPKKLAMYSQQAY QDAQRFSTTAVWQQWQPLMKAAADFYQVEGATQR
EMBL CDSCCC79936.1
Sequence length504 AA
Function in Native Organism 1) Deletion studies of Six TagE show that both Both TagE5 and TagE6 are required for protein glycosylation in L. plantarum WCFS1.
String220668.lp_2844
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.119
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationMALDI-TOF MS/MS and LC-MS/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name Acm2
ProGPdb ID ProGP436
Litrature
Year Of Validation2014 
Reference Lee, I.C., van Swam, I.I., Tomita, S., Morsomme, P., Rolain, T., Hols, P., Kleerebezem, M. & Bron, P. A. (2014). GtfA and GtfB are both required for protein O-glycosylation in Lactobacillus plantarum. Journal of bacteriology, JB-01401.

Authors Lee, I.C., van Swam, I.I., Tomita, S., Morsomme, P., Rolain, T., Hols, P., Kleerebezem, M. & Bron, P. A.
Research groupsTI Food and Nutrition, Wageningen, the Netherlands.
Corresponding Author Bron, P. A.
ContactsTI Food and Nutrition, Wageningen, the Netherlands.