Latest update: September 24, 2018


ProGT73 (STT3)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT73 (STT3)
Organism Information
Organism NameHaloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) (Halobacterium mediterranei)
Clinical ImplicationNon-pathogenic
DomainArchaebacteria
PhylumEuryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)523841
Genome Information
Gene BankCP001868
EMBLCP001868
Gene Information
Gene Namestt3
NCBI Gene ID13027753
NCBI Reference SequenceCP001868?
Protein information
Protein NameSTT3 
UniProtKB/ SwissProt IDI3R4Y8
NCBI Ref SeqWP_004056863.1
UniProtKB Sequence>tr|I3R4Y8|I3R4Y8_HALMT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=stt3 PE=4 SV=1 MSADTERIEDSGSKSVLELAKDWYHVPALLVILVGMLTLRLRSYSNFIRGGEVLFSGNDA WYHLREVTYTVQNWPSTMPFDPWTYFPFGTSVGQFGTIYDQIIATAALVVGLGSPSPDLV AKTLLVAPAVFGTLVAIPTFLIGRRLGGRTGGLFGVLILALLPGTFLRRGLVGFADHNIA EPFFQGFAVVTVMIALTVANREKPVWELVAARDFDALRSTLIWSALAGVAMAIYMWSWPP GVLLVGIFGLFLVLQMVADYVRGRSPEHVAFVGAVSLGVTGLLMFVPLHEMSFSATSFSL LQPVVSFVIALGAVFLAALARFWENNDVDDRGYPVAVGGLAVAGIVLISVVLPDAFNSIA RNFLRTVGFSAGAATRTIGEAQPFLSSSTLQRTGMTAAERIMSEYGFTFFTGLVGAIWLV GKPLVSEGDTRKVGYVFGSLAVIGLIFLAPAIPAGIGGLVGIDSALISLAIVTAIIVGAV LQADYESEHLFVLVWAAIITSAAFTQVRFNYYLAVVVAVMNAYLLREILSFDVIGLADVD RLENVSLGTVAVVAVALLLILTPVLMVPIQLGNAGTSSNALESARSGPGGVTQWQSTFDW MQNNTPEEGEFGGASNEMEYYGTYKATNDFEYADGTYGVMSWWDYGHWITVLGERIPNAN PFQQGAKEAANFLLAPNETQASNVLAEQSEEGNETRYVMVDWQMASTDSKFGAPTIFYNK QNVSSSDFYSAYYGLQRQDGQERLVSSTTLKDQRYYESLMVRLYEYHGSARNPSPIVVDW EERTSRDGSTTFKVTPSDNKPVKSFRTMDAAKAYVANDTTSQIGGLGAFPEERVAALEHY RLVKSSNSTALRSQSYYNSIASAGRTYGIQPRALLGNNPAWVKTFERVPGATVEGDGAPA NATVTARVEMRDPVSGTTFNYTQQAQTDANGEFTMTLPYSTTGYDDYGPDNGYTNVSVRA VDDYTFTGPTSFEGNNTFVTYQATNVSVEEGLVNGAEDGTVQVSLEQTEQEITLNESSSD DSSSDDAETNESTSASIDAGSVPAVAA
EMBL CDSAFK19298.1.
Sequence length1047 AA
Subcellular LocationMembrane (Integral component of membrane)
Additional Information1) AglB of Hfx. mediterranei is able to complement Hfx. volcanii AglB in AglB deleted Hfx. Volcanii cell.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Glycan Information
Glycan transferredHex-(HexA)2-HexA(methyl ester)-Hex 
Method of Glycan IndentificationLC-ESI MS/MS
Acceptor Subtrate Information
Acceptor Substrate name S-layer glycoprotein
ProGPdb ID ProGP71
Litrature
Year Of Validation2014 
Reference Cohen-Rosenzweig, C., Guan, Z., Shaanan, B., & Eichler, J. (2013). Substrate promiscuity: AglB, the archaeal oligosaccharyltransferase, can process a variety of lipid-linked glycans. Applied and environmental microbiology, AEM-03191.

Authors Cohen-Rosenzweig, C., Guan, Z., Shaanan, B., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.