Latest update: September 24, 2018


ProGT74 (FilmQ)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT74 (FilmQ)
Organism Information
Organism NameBurkholderia cenocepacia K56-2
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Burkholderiaceae
Order: Burkholderiales
Class: Betaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)216591
Genome Information
Gene BankAM747720
EMBLAM747720
Gene Information
Gene NameBCAL0111
NCBI Gene ID6930761
NCBI Reference SequenceNC_011000.1.
Protein information
Protein NameFilmQ 
UniProtKB/ SwissProt IDB4EDI5
NCBI Ref SeqWP_006484115.1
UniProtKB Sequence>tr|B4EDI5|B4EDI5_BURCJ Putative TPR repeat protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BCAL0111 PE=4 SV=1 MFSTELPATAALTPEQQLAQDIALVMENALERQRSGAFDDARALYEAILDAVPAHGDAHY NLAVLMVDTGQATDAVPHFEAAIGANPDNGYYWVSYIHALHRTGQTAAAWIAVEIAQQRG VHGPALDGLIAQLASPEVVLATAAVAPSGIDAAIVLETATGHAGRSDSGKPVRRPNQTLL QKHAALFDKNKHAEATALARQLVADYPQDGACWRALSASLHREGRFAEMIEAGFRTIELL PDELLVRMLLADTLRVMNRLEEADEQCTRLIQLQPDHPEAFRIRGLVLFALRRMDEAIAA CRRAVELAPGAAAPCGTLGFVLLEQGATQEAMGWLKRSIEINPTDSVTHSSMLFCITHIS DFDPQALITEHRKFGERYGNHKRKRAAVFSNSRDPARKLQVGFVSGDLFSHAVASYAVPV IEHLAADPGIAMHFYHNHFEEDHVSERFKAHATTWRTVAGMSDTAFLERVRNDRIDIVID LSGHTGRNRLVALAQRAAPVQASWIGYPATTGLAAMDYYLADRFLAPHGQFEDQFVERIV RLPAIASFMPPVNCPPVNVLPALHNGYTTYGSFNRLNKLSSHVIAVWARVLHADPTARMA LGAIGNEGDQQTLTEWFVAAGIDASRLSFHRRSNIPVYMQQHHGVDLCLDTFPYTGSTTT LNGLWMGVPTLTIPGSTMAGRGSASWLQHVGCDAYIANDEDDFVAKALALSSDTTTLQAL RAGLRARCSASAAFRPDVVAAGLSSALRTMWVRWCANEPVTAFDTPLFDDTATAPAAAEA
EMBL CDSCAR50419.1
Sequence length780 AA
String216591.BCAL0111
Additional Information1) flmQ encodes a glycosyltransferase, which is essential for FliC glycosylation and this glycosylation of FliC reduces TLR5-mediated signal transduction and gene expression in the host.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.B62.13625.
Mechanism of Glycan TransferSequential
Glycan Information
Glycan transferred4,6-dideoxy-4-(3-hydroxybutanoylamino)-D-glucose 
Method of Glycan IndentificationLC-MS-MS, GC/MS
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name FliC
ProGPdb ID ProGP494
Litrature
Year Of Validation2014 
Reference Hanuszkiewicz, A., Pittock, P., Humphries, F., Moll, H., Rosales, A.R., Molinaro, A., Moynagh, P.N., Lajoie, G. & Valvano, M. A. (2014). Identification of the flagellin glycosylation system in Burkholderia cenocepacia and the contribution of glycosylated flagellin to evasion of human innate immune responses. Journal of Biological Chemistry, jbc-M114.

Authors Hanuszkiewicz, A., Pittock, P., Humphries, F., Moll, H., Rosales, A.R., Molinaro, A., Moynagh, P.N., Lajoie, G. & Valvano, M. A.
Research groups1 Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queens University, Belfast BT9 7AE, Ireland, United Kingdom. 2 Don Rix Protein Identification Facility, Department of Biochemistry, University of Western Ontario, London, Ontario N6A 5C1, Canada. 3 Institute of Immunology, Department of Biology, National University of Ireland at Maynooth, Maynooth, County Kildare, Ireland. 4 Bioanalytical Chemistry, Research Centre Borstel, 23845 Borstel, Germany. 5 Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada 6 Department of Chemical Sciences, University of Naples, Federico II, 80134 Naples, Italy. 7 Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queens University, Belfast BT9 7AE, Ireland, United Kingdom, the Institute of Immunology, Department of Biology, National University of Ireland at Maynooth, Maynooth, County Kildare, Ireland. 8 Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queens University, Belfast BT9 7AE, Ireland, United Kingdom, the Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada
Corresponding Author Valvano, M. A.
Contacts1 Centre for Infection and Immunity, School of Medicine, Dentistry and Biomedical Sciences, Queens University, Belfast BT9 7AE, Ireland, United Kingdom. 2 Department of Microbiology and Immunology, University of Western Ontario, London, Ontario N6A 5C1, Canada.