Latest update: September 24, 2018


ProGT75 (GtfA)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT75 (GtfA)
ProGT Pathway
Organism Information
Organism NameStreptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Streptococcaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)170187
Genome Information
Gene BankAE005672
EMBLAE005672
Gene Information
Gene NamegtfA
NCBI Reference SequenceNZ_AKVY01000001.1.
Protein information
Protein NameGtfA 
UniProtKB/ SwissProt IDA0A0H2URG7
NCBI Ref SeqWP_000158459.1
UniProtKB Sequence>tr|A0A0H2URG7|A0A0H2URG7_STRPN Glycosyltransferase Gtf1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gtf1 PE=1 SV=1 MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDN QVIWLYNHFTDIKIAPTSVTVDDVLAYFGGEESHREKNGKVLRVFFFDQDKFVTCYLVDE NKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNVAVLYQRTFYNEDGTPVYDILMN QGKEEVYHFKDKIFYGKQAFVRAFMKSLNLNKSDLVILDRETGIGQVVFEEAQTAHLAVV VHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKI VTIPVGSIDSLTDSSQGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSG GEDSLLREIIANHQAEDYIQLKGHAELSQIYSQYEVYLTASTSEGFGLTLMEAIGSGLPL IGFDVPYGNQTFIEDGQNGYLIPSSSDHVEDQIKQAYAAKICQLYQENRLEAMRAYSYQI AEGFLTKEILEKWKKTVEEVLHD
EMBL CDSAAK75833.1
Sequence length503 AA
Subcellular LocationMembrane (Integral component of membrane)
Potential Application1) Structural information of glycosyltransferase may help in rational designing of inhibitors to combat infectious diseases.
2) Development of antibodies against PsrP which could be used as a preventive measure against pneumococcal infections.
PDB ID 4PQG
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Accessory GT IDProGT75.1 ProGT75.2 ProGT75.3 ProGT75.4 ProGT75.5 ProGT75.6 ProGT75.7
Glycan Information
Glycan transferredMonosaccharide (GlcNAc) 
Method of Glycan IndentificationLTQ Orbitrap MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name PsrP (pneumococcal serine-rich repeat protein)
ProGPdb ID ProGP449
Litrature
Year Of Validation2014 
Reference Shi, W.W., Jiang, Y.L., Zhu, F., Yang, Y.H., Shao, Q.Y., Yang, H.B., Ren, Y.M., Wu, H., Chen, Y. & Zhou, C. Z. (2014). Structure of a novel O-GlcNAc transferase GtfA reveals insights into the glycosylation of pneumococcal serine-rich repeat adhesins. Journal of Biological Chemistry, jbc-M114.

Authors Shi, W.W., Jiang, Y.L., Zhu, F., Yang, Y.H., Shao, Q.Y., Yang, H.B., Ren, Y.M., Wu, H., Chen, Y. & Zhou, C. Z.
Research groupsHefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026, China
Corresponding Author Zhou, C. Z.
ContactsHefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026, China.
Reference Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z. (2017). Defining the enzymatic pathway for polymorphic O-glycosylation of the pneumococcal serine-rich repeat protein PsrP. The Journal of Biological Chemistry, 292, 6213-6224.

Authors Jiang, Y. L., Jin, H., Yang, H. B., Zhao, R. L., Wang, S., Chen, Y., & Zhou, C. Z.
Research groups1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China and. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.
Corresponding Author Zhou, C. Z.
Contacts1 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China and. 2 Key Laboratory of Structural Biology, Chinese Academy of Science, Hefei, Anhui 230027, China. 3 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China. 4 Hefei National Laboratory for Physical Sciences at the Microscale and School of Life Sciences, University of Science and Technology of China.