Latest update: September 24, 2018


ProGT77 (GtfA)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT77 (GtfA)
Organism Information
Organism NameStaphylococcus aureus
Clinical ImplicationPathogenic
DomainBacteria
PhylumFirmicutes
ClassificationFamily: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Phylum: Firmicutes
Taxonomic ID (NCBI)450394
Genome Information
Gene BankAASB02000025
EMBLAASB02000025
Gene Information
Gene NamegtfA
NCBI Reference SequenceAASB02000025?
Protein information
Protein NameGtfA 
UniProtKB/ SwissProt IDA0A0E1VPL4
NCBI Ref SeqWP_000158427.1
UniProtKB Sequence>tr|A0A0E1VPL4|A0A0E1VPL4_STAA3 Glycosyltransferase Gtf1 OS=Staphylococcus aureus subsp. aureus USA300_TCH959 GN=gtfA PE=3 SV=1 MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQ EVIWLYQYFSDISIAPTTYTLDDIERELGHEISFRERNGKIVRLYFNGKSSFVTCYLQNE QKDVVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLYMRQFYNEDGSIAYNEYID GDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASDIGQAVLQHKGDSKVGVVI HADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVY TIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGS EKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMI GLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVVAKLAHAIVMYFNNGPQTPHDISYEVA QQFMTQDIILKWETLVQEVLHD
EMBL CDSEES94654.1
Sequence length502 AA
Subcellular LocationMembrane (Integral component of membrane)
Additional Information1) The deletion studies of GtfA and GtfB show that both GtfA-GtfB is involved in the transfer of GlcNAc residues to the peptide backbone of SraP.
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
CAZY FamilyGT4
EC Number (BRENDA)2.4.1.119
Mechanism of Glycan TransferSequential
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-GlcNAc
Glycan Information
Glycan transferredOligosaccharides  
Method of Glycan IndentificationsWGA blotting
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name SraP
ProGPdb ID ProGP245
Litrature
Year Of Validation2014 
Reference Li, Y., Huang, X., Li, J., Zeng, J., Zhu, F., Fan, W., & Hu, L. (2014). Both GtfA and GtfB are required for SraP glycosylation in Staphylococcus aureus. Current microbiology, 69(2), 121-126.

Authors Li, Y., Huang, X., Li, J., Zeng, J., Zhu, F., Fan, W., & Hu, L.
Research groups1 Department of Laboratory Medicine, Union Hospital, Tongji Medical CollegeHuazhong University of Science and TechnologyWuhanChina 2 Department of Otorhinolaryngology, Union Hospital, Tongji Medical CollegeHuazhong University of Science and TechnologyWuhanChina 3. Department of Pediatric Dentistry, Schools of Dentistry and MedicineUniversity of Alabama at BirminghamBirminghamUSA 4. Department of Laboratory MedicineJingzhou First People’s HospitalJingzhouChina
Corresponding Author Hu, L.
ContactsDepartment of Laboratory Medicine, Union Hospital, Tongji Medical College Huazhong, University of Science and Technology, Wuhan, China.