Latest update: September 24, 2018


ProGT80 (AglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT80 (AglB)
Organism Information
Organism NameHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Clinical ImplicationNon-pathogenic
DomainArchaebacteria
PhylumEuryarchaeota
ClassificationFamily: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)478009
Genome Information
Gene BankAM774415
EMBLAM774415
Gene Information
Gene NameaglB
NCBI Reference SequenceAM774415
Protein information
Protein NameAglB 
UniProtKB/ SwissProt IDB0R4T2
NCBI Ref SeqWP_010902766.1
UniProtKB Sequence>tr|B0R4T2|B0R4T2_HALS3 Dolichyl-monophosphooligosaccharide--protein glycotransferase AglB OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=aglB PE=4 SV=1 MSETTDASGLSAGLPSRALGALKDWYHVPVLGAVLAFMFWVRVQSWDNFLQNGEVYLSGN DAYYHLRQVTYTVHHFPETMPFDPWTNFPHGTLAGQFGTLFDQILAAVALVVGMGSPSEH TIAMTLLLAPPVFGALLVVPTYVMGRRIAGRLGGLFGAVILGLLPGYFLQRTLAGAADHN GAEPLFMTLAVVGLMVALSVAEREKPVFEQFRAWDATGLRDVVGWSVLAGVATAVYMWVW PPGVLLVGIFGAFFLVKLVGDYVTGTSPDHVAVVGAVSMTTTALLMFAPLGESGFGVSGF SFLQPVFALGVAVGCVVLAWLARVFDERSLSPAAYVATVAGTLVVVVGALALVAPGFWSS LQSNLLNYIGLSSTADTRTIGEAQPFLFRTGRYGLGMFGVVFLEYGTAFFSALVGAGAIL LKPHLTSGSVRRIVGVAGATAVLAIVAVSPAVPAAIGGVVGLGGQLTALLIAAVVLAAIA ATGQYDADKLLLVVWGAFVTSAAFTQVRFNYYLVVPVVVLNAYVLRAVLAAVDLDRPVAA IEGVSWYQVGTVVIVALIVLVPVAAPAVAEATNNDSASGPVSPIKLSNNQNQPVPLQSAI TAGQGQGPGGVVAWDDAMDWYQSHTPKQGTYGGADNADALDYNGTYSQTEDFDYPAGSFG VLSWWDYGHWMTVQGHAIPHANPFQQGATSAANFLLADDEQQSESVLADIEEDDAKNRYV AVDWKMVMPPLPYLSSGQSKFSAPVVFYDGPRDLSQGDFYQQAYNADWEENRISNARFFR QSPLLKKQAYYESMMVRLYRYHGSAKQAEPVVADWRRSVNTGQGTAAAFDAATNNTKQFD SMADAKAYVRNDSTAQIGGTGSLPEADVAALEHYRLVGVSANHTAPANLWYLGGELSTEY YPTSVKLFERVDGAAVTGTGPANTTVKASVELNLTQMESNEGTHPSFTYTQYADTDADGE FTMRLPYSTTGYDELGPANGHTNVSVRATGPYTFTAGDQAGNASAVAADTASVSESQVVS DEATPVTVSLDPTGGAAGNETATNGSVATPTADGESADGDGTDADTTNSTAGALPARVGA ELTHRGH
EMBL CDSCAP13747.1
Sequence length1087 AA
Subcellular LocationMembrane (Integral component of membrane)
Potential Application1) Understanding of N-glycosylation in Archaea could help to develop glycoengineering tool.
Additional Information1) Deleted Hfx. volcanii AglB can be functionally replaced by Hbt. Salinarum AglB.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferEn Bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityDol-PP-Pentasaccharide
Accessory GT IDProGT80.1 ProGT80.2 ProGT80.3 ProGT80.4 ProGT80.5 ProGT80.6 ProGT80.7 ProGT80.8 ProGT80.9 ProGT80.10
Glycan Information
Glycan transferredPentasaccharide (Hex-(HexA)2-HexA(methyl ester)-Hex ) 
Method of Glycan IndentificationLC-ESI-MS
Experimental_strategiesIn vivo 
Litrature
Year Of Validation2014 
Reference Cohen-Rosenzweig, C., Guan, Z., Shaanan, B., & Eichler, J. (2013). Substrate promiscuity: AglB, the archaeal oligosaccharyltransferase, can process a variety of lipid-linked glycans. Applied and environmental microbiology, AEM-03191.

Authors Cohen-Rosenzweig, C., Guan, Z., Shaanan, B., & Eichler, J.
Research groupsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.
Corresponding Author Eichler, J.
ContactsDepartment of Life Sciences, Ben Gurion University of the Negev, Beersheva, Israel.