Latest update: September 24, 2018


ProGT84 (PglLComP)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT84 (PglLComP)
Organism Information
Organism NameAcinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Moraxellaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)62977
Genome Information
Gene BankCR543861
EMBLCR543861
Gene Information
Gene NamepglL2
Protein information
Protein NamePglLComP 
UniProtKB/ SwissProt IDQ6F7F9
NCBI Ref SeqWP_004923783.1
UniProtKB Sequence>sp|Q6F7F9|PGLL2_ACIAD ComP-specific O-oligosaccharyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pglL2 PE=3 SV=1 MNSIFKKIKNYTIVSGVFFLGSAFIIPNTSNLSSTLYKELIAVLGLLILLTVKSFDYKKI LIPKNFYWFLFVIFIIFIQLIVGEIYFFQDFFFSISFLVILFLSFLLGFNERLNGDDLIV KKIAWIFIIVVQISFLIAINQKIEIVQNFFLFSSSYNGRSTANLGQPNQFSTLILITLFL LCYLREKNSLNNMVFNILSFCLIFANVMTQSRSAWISVILISLLYLLKFQKKIELRRVIF FNIVFWTLVYCVPLLFNLIFFQKNSYSTFDRLTMGSSRFEIWPQLLKAVFHKPFIGYGWG QTGVAQLETINKSSTKGEWFTYSHNLFLDLMLWNGFFIGLIISILILCFLIELYSSIKNK SDLFLFFCVVAFFVHCLLEYPFAYTYFLIPVGFLCGYISTQNIKNSISYFNLSKRKLTLF LGCCWLGYVAFWVEVLDISKKNEIYARQFLFSNHVKFYNIENYILDGFSKQLDFQYLDYC ELKDKYQLLDFKKVAYRYPNASIVYKYYSISAEMKMDQKSANQIIRAYSVIKNQKIIKPK LKFCSIEY
EMBL CDSCAG70006.1.
Sequence length548 AA
Subcellular LocationMembrane (Integral component of membrane)
String62977.ACIAD3337
Glycosyltransferase Information
Glycosylation TypeO- (Ser/Thr) linked 
EC Number (BRENDA)2.4.99
Mechanism of Glycan TransferEn Bloc
Donor TypeLipid linked sugars
Glycan Information
Glycan transferredPentasaccharide (HexNAc - HexNAc -HexNAc-HexNAc-HexNAc) 
Method of Glycan IndentificationLC-MS, and MS-MS (CID and HCD)
Experimental_strategiesIn vivo 
Acceptor Subtrate Information
Acceptor Substrate name ComP
ProGPdb ID ProGP196
Litrature
Year Of Validation2015 
Reference Harding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. & Feldman, M. F. (2015). A cinetobacter strains carry two functional oligosaccharyltransferases, one devoted exclusively to type IV pilin, and the other one dedicated to O?glycosylation of multiple proteins. Molecular microbiology, 96(5), 1023-1041.

Authors Harding, C.M., Nasr, M.A., Kinsella, R.L., Scott, N.E., Foster, L.J., Weber, B.S., Fiester, S.E., Actis, L.A., Tracy, E.N., Munson Jr, R.S. & Feldman, M. F.
Research groups1 Center for Microbial Pathogenesis, The Research Institute at Nationwide Childrens Hospital, Columbus, OH, USA. 2 Department of Pediatrics, College of Medicine, The Ohio State University, Columbus, OH, USA. 3 Biomedical Sciences Graduate Program, College of Medicine, The Ohio State University, Columbus, OH, USA. 4 Department of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada. 5 Centre for High-Throughput Biology, University of British Columbia, Vancouver, BC, Canada. 6 Department of Microbiology, Miami University, Oxford, OH, USA
Corresponding Author Feldman, M. F.
ContactsDepartment of Biological Sciences, University of Alberta, Edmonton, AB, T6G 2G2, Canada.