Latest update: September 24, 2018


ProGT88 (HMW1CKk)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT88 (HMW1CKk)
Organism Information
Organism NameKingella kingae strain 269-492
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)504
Genome Information
Gene BankLN869922
EMBLLN869922
Gene Information
Gene Namehmw1CKk
NCBI Gene ID29365636
NCBI Reference SequenceCRZ19328.1
Protein information
Protein NameHMW1CKk 
UniProtKB/ SwissProt IDA0A0P1CZQ3
UniProtKB Sequence>tr|A0A0P1CZQ3|A0A0P1CZQ3_9NEIS Adhesin processing protein OS=Kingella kingae GN=KKKWG1_0152 PE=4 SV=1 MTQTTEQSIPSLTRFEQAVSSQNYEAACTELLSILGQLDSNFGEIHGIEFAYPVQLQNLQ QDVTIHFCTRMATAITTLFTNKMWSLTDDGRTRFLTVQRWINMIFASSPYVNADHVLATY NTNPEPDSLWNNIHLDNNQSAFNKFAVMYLPESNVQVNLDSLWSVNPSLTASLCFAWQSP RFIATEAAFNRRAQVLQWFPAKLAQFNNLNTLPANISHDVYMHCSYDIEPNKHDVKGALN QVIRRHILEEYGWQDCDVTKIGNAHGKPVMLVLLEHFHSGHSIYRTHSTSMIAAREQFYL IGIGGAAVDEAGRAVFDEFVEIDAKASTMEKLQAIRAIATKEQPAVFYMPSIGMDLITIF ASNTRIAPIQVIALGHPATTHSKFIEYVIVEDDYVGSEECFSETLLRLPKDALPYVPSAL APASVEYNLRENPSVVHIGVASTTMKLNPYFLRACAEIKARSKVPVHFHFAMGQASGVTF AYIERFLKTYLGKAVTAYPHQSYTDYLRTLHQCDMMINPFPFGNTNGIIDMVTLGLVGIC KTGAEVHEHIDEGLFKRLGLPEWLITQTADDYVNCAVRLAENHEERLALRRHIIENNGLN TLFSGDPKPMGQILWAKVQEKMAKPAKKATAKVASKPATAVEPVAEKPATKTVRKTASKK AAATEATTEKAAPKTTRTRKKAAE
EMBL CDSCRZ19328.1
Sequence length684 AA
Subcellular LocationCytoplasm
Function in Native Organism 1) Glycosylation is important for autoaggregation and adherence to human epithelial cells.
Potential Application1) Glycoprotein Knh may be the potential candidate for vaccines production.
2) The first step in infection is adherence to host tissue, the ability to interrupt HMW1C-mediated glycosylation may have therapeutic potential.
Additional Information1) First examples of trimeric autotransporters that are modified by HMW1C-like enzymes.
2) Glycosylation required for normal functioning such as adherence and autoaggregation of acceptor protein.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT41
EC Number (BRENDA)2.4.1.-
Mechanism of Glycan TransferSequential
Acceptor specificity Sequon_1Asn-Xaa-Ser/Thr
Donor TypeNucleotide activated sugars
Donor SpecificityUDP-Hexose
Glycan Information
Glycan transferredMonosaccharide (Hexose) 
Method of Glycan IndentificationLC-MS/MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name Knh
ProGPdb ID ProGP513
Litrature
Year Of Validation2015 
Reference Rempe, K. A., Spruce, L. A., Porsch, E. A., Seeholzer, S. H., Nørskov-Lauritsen, N., & Geme, J. W. S. (2015). Unconventional N-linked glycosylation promotes trimeric autotransporter function in kingella kingae and Aggregatibacter aphrophilus. MBio, 6(4), e01206-15.

Authors Rempe, K. A., Spruce, L. A., Porsch, E. A., Seeholzer, S. H., Nørskov-Lauritsen, N., & Geme, J. W. S.
Research groupsThe Childrens Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA
Corresponding Author Geme, J. W. S.
ContactsThe Childrens Hospital of Philadelphia, Philadelphia, Pennsylvania, USA University of Pennsylvania Perelman School of Medicine, Philadelphia, Pennsylvania, USA