Latest update: September 24, 2018


ProGT90 (PglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT90 (PglB)
Organism Information
Organism NameCampylobacter concisus 13826
Clinical ImplicationPathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)360104
Genome Information
Gene BankCP000792
EMBLCP000792
Gene Information
Gene NamepglB
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDA7ZET6
NCBI Ref SeqWP_012140185.1
UniProtKB Sequence>tr|A7ZET6|A7ZET6_CAMC1 Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter concisus (strain 13826) GN=pglB PE=4 SV=1 MNRNLFFKNYSLYLMIFVAVLFGMVCRLYWVFWASEYPVFFWNNELMISTNDGYAFAEGA RDMLAGFHQENDLSYYGYPLSTLTYWIVKFLGVKLETAMIYMSVFFSSLVAVPVILIANE YKAKMAGFIAALLAVVANSYYNRTMAGYYDTDMLIIPLSVFVVWGLVRVLEKKDAKSLII APLSVLIYMWWYMSAFSLISILTGLFLLYTLIFDRKNPLFYLEISLLLLAISNLDLTLKF IAVIAIYALCLFKKEVINLKIALGILAIIFVVFVVRGGLNPIIFQLKFYVFRDAPEVGGM SFYFFNVNQTIQESSVVDFTLFCERISANVITFLISLVGVALFCYRHRSFAVSLGMLALG FLAFKSGLRFTIYAVPIMALGFGYLVEFILSNLKLKGLVLGLSRAVITALALTPALIHIY GYKAEPVFVNKEVEILNKLKSIAGREDYVLAWWDYGYPIRYYSDVKTLIDGGKHLGRENF AVSFALGSDEMSSANMARLDVEYTERNFKERFNGNLAQILKDRNLSVDQFFSEIKEANFS LPAKSREIYYYLPDRMLSIFPTILQFSKIDLKSGKNLNNGLFITTRAISQSEKGIRLSGG FTLTSDVTNLIYDGNVLPLRSFIETDYNEAGKLNVKEYKNNESSNISVIFMRDYGRFIIL DESILNSAYIQLFVLERYDPKVFEPVILDGAAKVYRLKR
EMBL CDSEAT99265.1
Sequence length699 AA
Subcellular LocationMembrane (Integral component of membrane)
String360104.CCC13826_0452
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name TAMRA-GDQNATAF
Litrature
Year Of Validation2015 
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.