Latest update: September 24, 2018


ProGT96 (DgPglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT96 (DgPglB)
Organism Information
Organism NameDesulfovibrio gigas DSM 1382
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Desulfovibrionaceae
Order: Desulfovibrionales
Class: Deltaproteobacteria or Deltabacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)1121448
Genome Information
Gene BankCP006585
EMBLCP006585
Gene Information
Gene NameDGI_2311
Protein information
Protein NameDgPglB 
UniProtKB/ SwissProt IDT2GBX6
UniProtKB Sequence>tr|T2GBX6|T2GBX6_DESGI Uncharacterized protein OS=Desulfovibrio gigas DSM 1382 = ATCC 19364 GN=DGI_2311 PE=4 SV=1 MSAPWNAVAPEQPARQELKLFLFVLGFTYALALAVHMHEIYGWQNPALVVDGEFIQGTHD SYHWLAGAKGVGEAVGTPLAVMAAGFASLTGMPLGLAGFVIPPLFAGLVGLVMAVWCRVL GWKEGAAAGGLVAGLLTVLSPGFYFRSRLGYYDTDMVTLLFPLLFTLGLAMAMGRWIRPS WRHREPLQEEPPQTIARVLAWLVLLGLLARFGAVWHGHILTFVKVLCGFSVCWGLAAGRP GARGRLMLGLAVFMASALVGWPGLACSLALWALAWKKPEMVSQWARAPWPGLAALVLLAV LGGVAQTTLQSATELLGAYLKPAADVTGSVNTTGVIYPGIGQSVIEVQNIALERVLERFH TSWLVAATGLLCFLGVLVLRPVALPLAIFLVMGLASVKLGSRLTMFGGAPMAIGLGMAVG WAGVALFRSGPGAGYKRFLLSCAATVVLGWPLVSFYISLPPTPVLSRQHCMALQSLKTSP PESKVWTWWDWGYPTHYYAERISFADGGRHYGHHIFPLGLVLTTPNPRLSAQLIKYSAQW NDEPWKAWDAMPRNEMLALLQGLGNATQPLPPFAAPRYVVATFENIRLAPWITYYGTWDM TTQQGLHGRLLEIRDAFRINYEKGEVQFTQREGVLPVASIDVLDRKERRSDVFPRNQGPH LVVHMAAQKYYLLDDQIYNSMMVQLLLEDPKKPRFGDYFSLVYDDFPDVRVFEVR
EMBL CDSAGW14065.1
Sequence length715 AA
Subcellular LocationMembrane (Integral component of membrane)
Additional Information1) Among various homologs of PglBCj only PglBDg exhibited most relaxed specificity, glycosylate the Fc domain of human immunoglobulin G (IgG) at its native ?QYNST? sequon, the first example of native Fc glycosylation in E. coli.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asp/Glu- Asn-Xaa-Ser/Thr
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name scFv13-R4 AQNAT
Acceptor Substrate name AcrA
ProGPdb ID ProGP217
Acceptor Substrate name scFv13-R4 CQNAT
Acceptor Substrate name scFv13-R4 EQNAT
Acceptor Substrate name scFv13-R4 GQNAT
Acceptor Substrate name scFv13-R4 HQNAT
Acceptor Substrate name scFv13-R4 MQNAT
Acceptor Substrate name scFv13-R4 NQNAT
Acceptor Substrate name scFv13-R4 QQNAT
Acceptor Substrate name scFv13-R4 SQNAT
Acceptor Substrate name scFv13-R4 TQNAT
Acceptor Substrate name scFv13-R4 VQNAT
Acceptor Substrate name scFv13-R4 WQNAT
Acceptor Substrate name scFv13-R4 YQNAT
Acceptor Substrate name scFv13-R4 LQNAT
Acceptor Substrate name scFv13-R4 FQNAT
Acceptor Substrate name DYNST
Acceptor Substrate name TAMRA-GAQNATAF
Acceptor Substrate name TAMRA-GDQNATAF
Litrature
Year Of Validation2015 
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.