Latest update: September 24, 2018


ProGT97 (DvPglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT97 (DvPglB)
Organism Information
Organism NameDesulfovibrio vulgaris subsp. vulgaris str. Hildenborough
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Desulfovibrionaceae
Order: Desulfovibrionales
Class: Deltaproteobacteria or Deltabacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)882
Genome Information
Gene BankAE017285
EMBLAE017285
Gene Information
Gene NameDVU_1252
Protein information
Protein NameDvPglB 
UniProtKB/ SwissProt IDQ72CN1
NCBI Ref SeqWP_010938548.1
UniProtKB Sequence>tr|Q72CN1|Q72CN1_DESVH Membrane protein, putative OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303) GN=DVU_1252 PE=4 SV=1 MTRLRGTLSVCIDAFPAWTRPLALAFVVYALSFGMRMLEYPAWQNPEYMLDGEYLLATHD AYHWIAGAEGFEFGAGHPMSELVRLAAAFTGTTPAAVGFWLPPVMASLVAVGVFGWAAAL GGVEAGVCAGVLASLAPGFLARTLLGYCDTDLVTLLFPLLMGLGPAFWMARFMFTPLQVA RRLLARRTGTSDVVPDAVAVMMTSRGEADDDWHGGALSPRWLALLAGSGLVGSWGAEWHS LFPYLIRYDVVLLFGCICVFGRPGMRRALLVGGLAYALPMLVGAWGLLFALALGWGLHRA DARFMAFVRGRALPVAGWCAVAVLLFDPDVFRMFLNSIAGYVKRSGDPSPGAGGDDPLVY PSVAQSIIEVQDLSLSEVLSYFHPWLWVALAGLGGFVPLLLARPAAFFLLPLGVLSFLSV KLGGRMVMFGAPVLALGFALPMVWGVQRVLRHDLRTGWVRLALSAVLLVIVATPFVDLLP AMTQGPIINKRHAEALRHIRTATPEDSMVWIWWDWGYSAHHFAHRRTIADGASHGGPSLY VPAAVFSTANPRFAWQLIRYTAERGGIPGSVFEGMGGAQAQELVHRLGIEKMTFADAPRQ YLVVSYDMLRLGFWITNFGTWDFLSREGKGYAISSIPQQLSYSLDTGEVQVQGNTTGVLA STIDVFDEGQLERRDYIVRQGGSGNAIADYAARQRNIESRRNIHFLFNKVTGEKLVLDDR LYNTVMVQLLLCSPDDTRFAPYFKLIYDNVYARVYEVR
EMBL CDSAAS95730.1
Sequence length758 AA
Subcellular LocationMembrane (Integral component of membrane)
String882.DVU1252
Additional Information1) It is able to transfer glycans to the acceptor sites and has relaxed substrate specificity towards negatively charged residue in the ?2 position relative to the asparagine as compare to C. jejuni PglB.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA)2.4.99.18
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 LQNAT
Acceptor Substrate name scFv13-R4 MQNAT
Acceptor Substrate name scFv13-R4 QQNAT
Acceptor Substrate name TAMRA-GDQNATAF
Litrature
Year Of Validation2015 
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.