Latest update: September 24, 2018


ProGT99 (PglB)

Home -> ProGTdb -> Search ProGT_Main -> Display data

ProGT ID ProGT99 (PglB)
Organism Information
Organism NameWolinella succinogenes
Clinical ImplicationNon-pathogenic
DomainBacteria
PhylumProteobacteria
ClassificationFamily: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Phylum: Proteobacteria
Taxonomic ID (NCBI)273121
Genome Information
Gene BankBX571657
EMBLBX571657
Gene Information
Gene NameWLAF
Protein information
Protein NamePglB 
UniProtKB/ SwissProt IDQ7MAT3
NCBI Ref SeqWP_011138014.1
UniProtKB Sequence>tr|Q7MAT3|Q7MAT3_WOLSU PUTATIVE INTEGRAL MEMBRANE PROTEIN POSSIBLE OLIGOSACCHARYLTRANSFERASE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=WLAF PE=4 SV=1 MKPQPLSSPPHRGQASLDIGLALLLFLFALGARLAWVVDFGAYEEFLHKGILMINTNDGY YYAEGARDLIAGFHQENDLSPLHTPLSLLTAWLYHLTPFSLEALLLGMPLFFGASIVFPL YLLGKELASRNVGFFGALLGGVAVSYYNRTMAGYYDTDMLVLVLPLWMFYFLFKFLKEPR ALFWILSVLFGIASVLWHNGLANLYVGVFLIGILYLLFFEESNPKRWHALSLILLLCLPN PSFLQIGVVILLGFWIAQTPSLNPSLAPWFTLALLIWVLFGGALSPLWYQLEVYLFRPSV EASAPSLHFYSVVQTIREASTLSLEKLAIRISGHPLSFGLALLGYLLLAFKRPLFWLTLP FVALGFLGMKSGLRFTLFAVPFMALSLGFLIESILAQIPQKLWRFPLFALATLLALWPNL NHILDYQIPPVFKAKEVHLLETFKGIANREDYVMAWWDYGYGLRYYSDVKTLIDGAKHAG NINYPVSYALLSQNALASANMARLSVEFTERSFEEGWNGDEVVAKIMEHYGFSDPNAFLE ALSQDALPLPPKSREIYYYLPLKMMEILPTVDLFSHLDLSTGHSKESGFFFYTQNFIDQK DFIDLGRGLRIDKTEGILEFQSGERVALREFIITQEEEGEVHSKSLKLDSAAPLYAVYMK NQRAIFLADEHYFHSLFIQLFALGDYDSTLFEPILSSPWAKIYKLKR
EMBL CDSCAE09214.1
Sequence length707 AA
Subcellular LocationMembrane (Integral component of membrane)
String273121.WS0043
Additional Information1) It able to transfer glycans to the acceptor sites, predominantly to the sites having a negatively charged residue in the ?2 position relative to the asparagine.
Glycosyltransferase Information
Glycosylation TypeN- (Asn) linked 
CAZY FamilyGT66
EC Number (BRENDA) 2.4.1.-
Mechanism of Glycan TransferEn bloc
Acceptor specificity Sequon_1Asn-Xaa-Ser
Donor TypeLipid linked sugars
Donor SpecificityUndPP-Heptasaccharide
Glycan Information
Glycan transferredHeptasaccharide 
Method of Glycan IndentificationLC-MS
Experimental_strategiesIn vivo and In vitro 
Acceptor Subtrate Information
Acceptor Substrate name scFv13-R4 DQNAT
Acceptor Substrate name TAMRA-GDQNATAF
Litrature
Year Of Validation2015 
Reference Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P. (2015). Substitute sweeteners: diverse bacterial oligosaccharyltransferases with unique N-glycosylation site preferences. Scientific reports, 5, 15237.

Authors Ollis, A.A., Chai, Y., Natarajan, A., Perregaux, E., Jaroentomeechai, T., Guarino, C., Smith, J., Zhang, S. & DeLisa, M. P.
Research groups1 School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY 14853 USA. 2 Department of Microbiology, Cornell University, Ithaca, NY 14853 USA. 3 Comparative Biomedical Sciences, Cornell University, Ithaca, NY 14853 USA. 4 Proteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York.
Corresponding Author DeLisa, M. P.
ContactsProteomics and Mass Spectrometry Core Facility, Cornell University, Ithaca, New York 14853.