Total Record - 1

Print this rrecord

 
ProGlyProt ID
AU102
Organism Information
Organism Name
Haloarcula japonica strain TR-1
Domain
Archaea
Classification
Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
csg
 
 
Protein Information
Protein Name
Cell surface glycoprotein (S-layer protein)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|Q9C4B4|CSG_HALJP Cell surface glycoprotein OS=Haloarcula japonica GN=csg PE=
1 SV=1 MTDTQQKIKAVLLTVLMVTSVFAATIAFSGAAAASERGAGDSYTTGPTDGNQDNVDSAGN VGAGAVVF
QGEDDIEGEFADGNGDTVGIGELQKVSGDNEGILLESPIPQDQPTGRYTANP GVEGTEGVTLQTPRITDLEIQNS
DEGDVTGSILQANNDNTAEILVDYNYDEAEDLELTVE DEDGLEVTEEILADGASETVNTNVNNDDHPNPAADGDR
DDSFDAGFTINPSNVDEGEYTI TVEGVEDLDFGDASETATVEITTDQTASLSLDSDEVTQGEDLGFDIENSPEGN
FHAVVIE ESEFRDSASASNYAKVFRNVGDTSDRGLVGEDADGNTVAVAPGDADSLESIDYAYGIVEI DGGTGVG
SAETQYLDDSSIDIDLYEAANGDYTDNNAHVNDINLVTDDTYETDDEQDFDVL EGDLTIDSPSGTYVTGSEVDVN
GTASEGIDDVAIYARDNNDYELVEIDSEETISVDGDDT FSEEDISLSGGDLGGNDILGLPGTYRIGVVDVEDADS
NSNGTVDDSLTTSEFNSGVSSAE SLRVTDTELNGTFITYNGQISSDDNQIDVEGQAPGKDNLVIAFVDSRGNAVA
TDISVDDD DTFSEDDISISALSEGTVTAHIISSGRDNLFGDGVSDSSSGFASLIEEEYASGSSTGDQV RSRILE
NSVDDTASDDLIVNEQFRLADGLTIVESVNSPVEANGTIEIEGTTNRKPDDNTI TVELLDDEDESVTVDSTDEWS
SDGQWSVSLDLSDENVEPGNFTVEADDGDNTDRQSVQIV EAGSLEEEQPATDTPEPDTDTPEPATDTPEPATDTP
EPDTDTPEPDTETEEATTEATGPG FTAAIALIALVAAALLAVRRDN
Sequence length
862 AA (signal peptide 34 AA)
Subcellular Location
Surface
Function
It is the component of the S-layer. The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of the cell.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
PAS staining and phenol-sulfuric acid method
 
 
Glycan Information
Glycan Annotation
Contains N-linked glycans.
 
 
Literature
Reference(s)
1) Wakai, H., Nakamura, S., Kawasaki, H., Takada, K., Mizutani, S., Aono, R. and Horikoshi, K. (1997) Cloning and sequencing of the gene encoding the cell surface glycoprotein of Haloarcula japonica strain TR-1. Extremophiles, 1, 29-35. [PubMed: 9680334]
2) Nakamura, S., Mizutani, S., Wakai, H., Kawasaki, H., Aono, R. and Horikoshi, K. (1995) Purification and partial characterization of cell surface glycoprotein from extremely halophilic archaeon Haloarcula japonica strain TR-1. Biotechnol Lett, 17, 705-70.
Year of Identification
1995
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.