Total Record - 1

Print this rrecord

 
ProGlyProt ID
AU103
Organism Information
Organism Name
Haloarcula marismortui
Domain
Archaea
Classification
Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
phoD (rrnAC0273)
NCBI Gene ID
 
 
Protein Information
Protein Name
Alkaline Phosphatase D
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q5V573|Q5V573_HALMA Alkaline phosphatase D OS=Haloarcula marismortui GN=phoD
PE=4 SV=1 MRPTDLPEIDTTAQNRRTFMQRTGGVSLAAVLGLSKGASAMVDDDGNFESDPYTLGIASG DPLP
DSVIIWTRLAPNPLEADGAMPSETFSVEWTVATDEGMSDIVNTGTATAEPDHAHTI HVDADGLEPATEYYYQFAC
RGETSPIGRTKTAPAAGASVDAFQFGFASCNRWVDGHYTAF GQMAEDELDLIVHLGDYIYEYGIDVSESPREKSL
PQEYKKETTDLDTYRLRYGLYKSDPN LRAAHASAPWLVTRDDHEVDNNWAGNVPQDPDKQSTEAFIQRRAAALKA
YYEHLPFRMEQ KPDDASQKLYRYYEFGDLLDFNVLDTRLYRSDQACDDVFNKVDCAERFEEDRTILGDAQE EWL
LENLSATETTWNVLANQLPFATMDFKQGPEEGFRTEQWDGYVPEQNLVKTAFEEDAN NPVVITGDFHSHWANTLI
SAKDGSSEPVGAEFVGTSISSGGNGTDMDDFGRYVVTENDNV EYYNNQRGYVRCTVTPDNWTTEFQVLEYVDEPG
APMRTDATVELTAGQPGIPDDNPLILA DSIAVGNGKNGTAELTGRWLETGLSGAAMTVTISDPEIATITGVSVAD
PFSISETDVASD GASADIRFADVEKNAQSVVGGTDTRLATLDIRGQSAGTADIEVSVERLDDDSGTALVANT EL
GVIIVGPPPVTGSDEPTDPDGDGHFEDVNGNGRVDYDDIQLLFDNFDDDSVALNKTAY DFNENGKLEYDDIVTLYSEVN
Sequence length
741 AA
Subcellular Location
Secreted
Function
Extracellular Ca2+-dependent inducible alkaline phosphatase.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Determination of sugar content by modified ferric cyanide method; in vivo labeling with radioactive glucosamine.
 
 
Literature
Reference(s)
1) Goldman, S., Hecht, K., Eisenberg, H. and Mevarech, M. (1990) Extracellular Ca2(+)-dependent inducible alkaline phosphatase from extremely halophilic archaebacterium Haloarcula marismortui. J Bacteriol, 172, 7065-7070. [PubMed: 2123861]
Year of Identification
1990
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.