Total Record - 1

Print this rrecord

 
ProGlyProt ID
AU137
Organism Information
Organism Name
Pyrococcus furiosus DSM 3638
Domain
Archaea
Classification
Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
cipB (PF1408)
NCBI Gene ID
 
 
Protein Information
Protein Name
CipB (putative dipeptide-binding protein)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q8U121|Q8U121_PYRFU Putative dipeptide-binding protein OS=Pyrococcus furiosu
s GN=PF1408 PE=4 SV=1 MKKGLLAILLVGVMVLGTFGSGCIGGGTQTQTQTPTETGSPTQTTTPSGVTQAI
LELGKV TVVDTGTAIVVVGPKGEKPSVSIPSGKKVITVTYVVDEQNTPSVKELMEQGQGFGAINPA FFRDTNVD
ALVIAARRETNPEVRTEIFKALYILGNYYVPEVILGQNRQLRVYWDWVKGRY YHPTLPERYDLLWEDPNAPVVDT
GIGSYKNDPETYVIATIGWPESFDPAWTYETFGWEIW HEIGDTLVTYWKEETEQVTPDLAVAWAHNKEGTEWYFV
IRGGVKAYDPWNDKTYPIDATD VVFTFWRVARLGHSVSWMVTEFMNVSASQALTEEEFNNYVKNNPLIAEYNGKT
AEIKSLQ DLLNFFGYNGETAGVFKLVLPHPYAAVLNIVADPFLSVVPMEYLLGDKYEEALKASNYGK NPDAWEA
YVQEGVDDPTHQLMHKYPVGTGPFYVKEYQENSYIVLEYNPYYWNATSNPGHK RVIYIINNDAVARVQLLTTGTA
DVAAIPTDKIEDVQGVTKDGYKVVVQTDILLPVLTFIV FNTQKEPFNDVKVRQALAYAIPYDQIAKVVYNNLLER
NWGPIPKPWPGYTEYGIIKYEYN IAKAKQMLQEAGVDPSKYSITLIYNAGNTQREKVMTLIQNVWSQLGFRVTVE
SYEWPVYL SKTEHGDYDVYIVGWVPDYLDSDNWVGPFLYGATEFSEINIEVSG
Sequence length
705 AA
Subcellular Location
Membrane associated
Function
Cold induced protein. Up-regulated in response to the cold stress.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Pro-Q Emerald 300 staining.
 
 
Literature
Reference(s)
1) Weinberg, M.V., Schut, G.J., Brehm, S., Datta, S. and Adams, M.W. (2005) Cold shock of a hyperthermophilic archaeon: Pyrococcus furiosus exhibits multiple responses to a suboptimal growth temperature with a key role for membrane-bound glycoproteins. J Bacteriol, 187, 336-348. [PubMed: 15601718]
Year of Identification
2005
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.