Total Record - 1

Print this rrecord

 
ProGlyProt ID
AU140
Organism Information
Organism Name
Staphylothermus marinus F1
Domain
Archaea
Classification
Family: Desulfurococcaceae
Order: Desulfurococcales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Protein Information
Protein Name
Stable protease
UniProtKB/SwissProt ID
EMBL-CDS
AAB02323.1
UniProtKB Sequence
>tr|Q54437|Q54437_STAMA STABLE protease OS=Staphylothermus marinus PE=4 SV=1 MRR
LLVILSLIIIVGLIMPSLSLSAPVTVGNKDLNKFTIDPNWQNKIPKKLFDDVYTNAK IKKAAFMPYGIQTVKKIM
LFDSNSRTLLLIGDNSENTVRYIIQNTEKLLYKFPLLGNHVI YYVVATPDQVVKLAKYPGIYRITPSPPITKLIK
LNNMIKKAEGAGSSFEIKTADNNENAT IDTNMGVKLIGATEVWREYNITGEGIVVGIVDTGIDLSNPDLGLDVIA
RDDNGTPLLLAY DNGLTLVTGKAVAYNGTLNTTGLTVLAFDPLYTLVYGIPVLIEAQFNYNITVGNITSQSG IY
RVGLAPYLFSDTLTGYYIRTFVPVVLVDSETPGVYDEAYFDLSTAFYDLSEYMRYLEN VTLGHIYWRAPDPAWND
TSITDETPFGPGNEIVGRDFDGDGIIDFSIGTIAGYYLDSYGL ATLTYDPTTGNITLGTPGLYPGWDYQGRYLAL
VSDFHGHGTSVATVIASRGRVLYDLYGD GKLYRIMGVAPGAKIAGGDAWLLGNILVLEAWLAGFNIVTEEEDGYV
YLSLDPFGPHRAD IISNSWGSIYINFWLQQFPGIDYRSSFMDEILAIRNYLIGDHVTIVFAAGNEGPGYSSNG A
PGTGLLVITAGASTLWDYTRIYGYPEGYADEVIPFSSRGPTGQGYPKPDIVNIGAFEWA STRTIDGRGYGAQPDV
FGGTSEATPYTSGTLALVFQAYKEVYNTTPDPVTAKIILKSSAK DIWYPAFSQGSGRVDALKAADTVFISEWLAY
VSEGIQEAFLENYYTDFGPYIGYVLPYLA DTDYYGVVKPGSSKNFTLNIVGNGAVSLSAWNTVLYKEYTVYDGVY
DYSGLLFLKVPKYA YSGADYVEVVVQLENMTYPPGVFLKTPIDPLHAIILSAYDWIDYNGDGQIGYPDELHYIT
FEYRVSTEAVVSISAPMEKIHGDLVLRIRPDYINVTPVKMKIVVRSFKYVPCKLMSLPNT VDVNGTASIPITINV
PDNFRPGILEVRLIVDTPDKRIVVPVSILVPLIADETTTAVLGGA RSPMKYDPFAMYGLPDPVYGVWEGQDWRIL
PVLVTDPSITGLIVVARWASGYASDLSFLT VAPGGVFTPNGFLNVFASYKLSYDLGLVYNPSLSDQLHGKLRMYI
PVKWAEPLRQIPIAI TDLSYWPPEPGLALMQYSDRMPEIYGLYRIIYGFASYSGKLLEDKLMFRIITVKSEIQYS
EQFSFNNISVGNLYVKFTAGSYTPFLFADLYLYTEGYATPLAGSGSILPISILVNGTASN LAYYLVLYDYAYYL
GTSPTGLYSEFTVPVMINTSATNVFNAIAVMYKYSWHAEGMYWFDF NTGEPLIISYVHPGMASATLNISNT
Sequence length
1345 AA (24 AA signal peptide)
Subcellular Location
Surface
Function
Possesses peptidylglutamylhydrolyzing activity. It has both tryptic and chymotryptic activity, and is one of the most stable (thermostable) proteases.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Carbohydrate analysis using trifluoroacetic acid and GC/MS.
 
 
Glycan Information
Glycan Annotation
Carbohydrates (glucose, mannose, and glucosamine). Both N and O linked glycans present.
 
 
Literature
Reference(s)
1) Peters, J., Nitsch, M., Kuhlmorgen, B., Golbik, R., Lupas, A., Kellermann, J., Engelhardt, H., Pfander, J.P., Muller, S., Goldie, K. et al. (1995) Tetrabrachion: a filamentous archaebacterial surface protein assembly of unusual structure and extreme stability. J Mol Biol, 245, 385-401. [PubMed: 7837271]
Year of Identification
1995
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.