Total Record - 1

Print this rrecord

 
ProGlyProt ID
AU142
Organism Information
Organism Name
Sulfolobus solfactaricus
Domain
Archaea
Classification
Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
slp1 (SSO0389)
NCBI Gene ID
 
 
Protein Information
Protein Name
140–170 kDa surafce layer glycoprotein
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q980C7|Q980C7_SULSO Surface layer glycoprotein OS=Sulfolobus solfataricus (s
train ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=slp1 PE=4 SV=1 MNKTLGLILTSV
FLLSTLGIITGFVIPTQAANSNDAAIYTIPSVTSVSNTSNIVINLFFN ATSNSTVGAQASAFNYGLAINYTLDAI
TFTVVLPSGTSYPLIKLNAKNFANYGYYDLAHN SIVLLLNTTASSTAKELAYSYEQSIGVTPSASYKIYNYTNKT
VNVNQYMNELPLSMLIYM ATNGKYNNLASLPVGTKLEFTYAGVTYIIAVSPTVKLVGELLNPLYTANSKMLPGTN
YAV GRSNITVAVYDNLITTTTSPFNFTLTYSSLAPALIYWFVIANTTYTNNGASTPTASFQAP PFKQYFPSNST
ILYSAAPTKSSILMFNGQMNVTAHENVTLTLQTGTNIYTSPNFNVTPPG NYTFSGKLGVGFNGFIYQNGSATLTA
TIFNGTINFFFSSTGQKAAFTFFLVPIVPINLGD NNGATVIYNGVSLNTGFPQVVVMFNITGNFTKSGSNYLLYG
SVYEAELKPLGSTQLQKLA GATDSTQFVGNLISSASSPLVSYFNYGESTTTITGTSLSFTVLMPLKFIVERLGYI
YLVT FHIWGPSATVTVTGVDYHGTQIALGSFRAYVALPSFYTLPKTPLVGLTCDNMYTLAQVSD AGSVLETSTA
NSNANNATVIGPYDLMSNAGLHVAIYNGSKLVKSGNLGLLPNATTAPITT TITLNGQTVALTYSSAPTAIYPVDF
KFEPGFSYSVTTNVIYNTSIPTYVVTVYMPLKYIL QTKIVMWYVSPDYAAYFYYSSTGQYQTSNVTLTFANVTPE
LVMPQVFPVGKLYMPFGIND PYYVFYSSISIGPQSGVIEAVENGFNVGNITSITVELNGMNESIVLSPLNVSKLL
ISSNL GEVSQCSPLFTTTLFNISALASLLGLPNAAALNGSYLYVTYHDIISGAYVTNRTLLVVGQ FYVMPPTTP
GSVEWILTAKYINATTGIPVEISYAVVQQPSAKVVDINAANASITQIQVTG VKIVSKYATVTVMYNPSNASTIVY
MNGMFVASYGGNLISSLSETSTFGVYYGAVVNLYVA TGTLSSPNGTMYVVLGSHKVAVGTANLYTYAGYHFGPYT
ALPLVSNVTFTVQDPVTHATL TGQTTLGAFNNTPIRLAPLGVSIPQTAQYKVFYYYSTPLVLSPTSQYIVLSVTS
VISYPY PFYIETVSFLGYNVTTGTPVPGTPAFQTVYSPSLGPGVVLQVPVQSYQFISLSTPSEPHT VVMFAVPF
AGGPAISLYPTFLVYANVTAISS
Sequence length
1231 AA
Subcellular Location
Surface
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Thymol-sulfuric acid staining
 
 
Literature
Reference(s)
1) Grogan, D.W. (1989) Phenotypic characterization of the archaebacterial genus Sulfolobus: comparison of five wild-type strains. J Bacteriol, 171, 6710-6719. [PubMed: 2512283]
Year of Identification
1989
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.