Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU122
Organism Information
Organism Name
Bacteroides fragilis
Domain
Bacteria
Classification
Family: Bacteroidaceae
Order: "Bacteroidales"
Class: "Bacteroidia"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
The Bacteroides constitute the major population of human intestinal microbiota. They are beneficial to the humans in terms of metabolism, development, and immunity. They play roles in recycling of bile acids, provision of short-chain fatty acids to the host and angiogenesis.
 
 
Gene Information
Gene Name
BF0994
NCBI Gene ID
 
 
Protein Information
Protein Name
BF0994
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q5LGK6|Q5LGK6_BACFN Putative uncharacterized protein OS=Bacteroides fragilis
(strain ATCC 25285 / NCTC 9343) GN=BF0994 PE=4 SV=1 MATLQNIRSKGPLLVIVIGLALF
AFIAGDAWKVLQPHQSHDVGEVNGETLSAQDYQNMVE EYTEVIKFSSGMSSLNDEQTNQVKDEVWRSYVNNKLIE
KEAKKLGITVSKAEIQSIINEG VNPLLQQTPFRNPQTGAFDKDMLKKFLADYSKMDKTKMPSQYVEYYEGMHKLW
SFVEKTL IQSRLAEKYQALVTKALFSNPVEAQDAFDARVNQSDVLLAAVPYSSIVDSTITVKESELK DLYNKKK
EQFKQYVETRNIKYIDVQVIASAEDRAAIQQEVTDYTNQLATANGDYTTFIRS TGSEYPYVDLYYTKKAFPSDVV
ARMDSASIGQVYGPYYNAGDNTINSFKVLSKVAAADSV QFRQIQVYTEDAAKTKALADSIYTAIKGGADFTALAK
KYGQTGESNWISSANYENAQVDG DNLKFISTINNLGVNELSNVALGQGNIILQVTDKKAVKDKYKVAVIKRAVEF
SKETYNKA YNEFSQFIAANPTVDKVAANAEESGYKLLERNDLYSSEHGIGGIRGTKEALKWAFAAKPG EVSGLY
ECGESDRMLVVGLVSVIEEGYRPLAQVQDQLRAEIIRDKKAEKIMADMKAANAT TIAQYTSMANAVSDSVKHVTF
AAPAYVAALRSSEPLVGAYASVSDINKLSAPIKGNGGVF VLQVYAKDKLNETFDAQSEEATLENMHARLASRFMN
DLYLKGDVKDKRYLFF
Sequence length
712 AA
Subcellular Location
Periplasm
Function
Proline cis-trans isomerase (parvulin family)
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Mass shift detected on SDS-polyacrylamide gel, AAL (Aleuria aurantia lectin) reactivity, Pro-Q Emerald Glycostaining and reactivity towards anti-glycan antiserum
 
 
Glycan Information
Glycan Annotation
Exogenous fucose.
 
 
Literature
Reference(s)
1) Fletcher, C.M., Coyne, M.J., Villa, O.F., Chatzidaki-Livanis, M. and Comstock, L.E. (2009) A general O-glycosylation system important to the physiology of a major human intestinal symbiont. Cell, 137, 321-331. [PubMed: 19379697]
Year of Identification
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.