Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU135
Organism Information
Organism Name
Cellulomonas fimi
Domain
Bacteria
Classification
Family: Cellulomonadaceae
Suborder: Micrococcineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
man26A
 
 
Protein Information
Protein Name
Man26A (β-mannosidase 26A)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q9XCV5|Q9XCV5_CELFI Man26A OS=Cellulomonas fimi GN=man26A PE=1 SV=1MTNRSRPRG
RTAGHVLAATAAALALTGLSALPAQSAPAPAAPVAGALPTAPADETIAIVDADATAETRSLLSYLDGVRGEGILFG
HQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLIIEGNERPGLAENTRDENIALFADYIRKADAIGGVNTVS
AHVENFVTGGSFYDTSGDTLRAVLPGGSHHAELVAYLDDIAELADASRRDDGTLIPIVFRPWHENAGSWFWWGAAY
GSPGEYQELYRFTVEYLRDVKGVSNFLYAWGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAFLAGLVAD
LRMIAEIADEKGKVSAFTEFGVSGGVGTNGSSPAQWFTKVLAAIKADPVASRNAYMETWANFDAGQHFVPVPGDAL
LEDFQAYAADPFTLFASEVTGAFDRTVAAAPAQPVVHIASPADGARVASAPTTVRVRVGGTDVQSVTVEVAQGGTV
VDTLDLAYDGALWWTAPWSPTSAQLDNSTYTVTATATTAAGTLDVTNEVVLGPRPTFPAGVVDDFEGYGDDTALRA
EYVTYGANTISLETGSVGGGAKALRLDYDFATQTYTGVGKQLSGDWSDFNELAIWVDPDGSNNRMVLQLNAGGVAY
EAYPSLAGDEPQLVTIPFVDWRPAPWDTAHADRRMSDDDLRALTSFNVYVNSAEGGAASGSLVVDDIAAHPGVEPP
PLFSDVPKGHPYETEILWLHAQGLDDGYDDGTFRPARQVKRQDVARLLHAYEKAVFTPPTTPSFLDVRRSHPAYTA
IEWLVAEGLVDDGRVFLPSAPLDRATAAELLWRLAGSPEPEGTEAFRDVPTWHRYRTAITWATEVGVVEPVSASTF
GVLKAVQRQELARYLYRFDALPSPLEPVVLSDFADGAQGWGPLDAGPGSATASGGTLTIEAAAPDGGWFSFTPSVA
DWTGRTALALDVVSTTGFDTKAALQVGSTWQWCETAQAGWVSGPRTGDDALVLDLTTLYAGCGAQLADVKRVNLYL
NAGTHVIDDVELR
Sequence length
1010 AA
Subcellular Location
Secreted
Function
Catalyzes the removal of β-D-mannose residues from the nonreducing ends of oligosaccharides.
 
 
Protein Structure
PDB ID
2BVT, 2BVY, 2X2Y
 
 
Literature
Reference(s)
1) Stoll, D., Stalbrand, H. and Warren, R.A. (1999) Mannan-degrading enzymes from Cellulomonas fimi. Appl Environ Microbiol, 65, 2598-2605. [PubMed: 10347049]
Year of Identification
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.