Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU148
Organism Information
Organism Name
Clostridium thermocellum ATCC 27405
Domain
Bacteria
Classification
Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
cipA (Cthe_3077)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Cellulosome complex (Cellulosomal-scaffolding protein A)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>sp|Q06851|CIPA_CLOTH Cellulosomal-scaffolding protein A OS=Clostridium thermoce
llum (strain ATCC 27405 / DSM 1237) GN=cipA PE=1 SV=2MRKVISMLLVVAMLTTIFAAMIP
QTVSAATMTVEIGKVTAAVGSKVEIPITLKGVPSKGMANCDFVLGYDPNVLEVTEVKPGSIIKDPDPSKSFDSAIY
PDRKMIVFLFAEDSGRGTYAITQDGVFATIVATVKSAAAAPITLLEVGAFADNDLVEISTTFVAGGVNLGSSVPTT
QPNVPSDGVVVEIGKVTGSVGTTVEIPVYFRGVPSKGIANCDFVFRYDPNVLEIIGIDPGDIIVDPNPTKSFDTAI
YPDRKIIVFLFAEDSGTGAYAITKDGVFAKIRATVKSSAPGYITFDEVGGFADNDLVEQKVSFIDGGVNVGNATPT
KGATPTNTATPTKSATATPTRPSVPTNTPTNTPANTPVSGNLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSK
LTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVKMSSSTNNADTYLEISFTGGTLEPGAHVQIQGR
FAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWGKEPGGSVVPSTQPVTTPPATTKPPATTKPPATTIPP
SDDPNAIKIKVDTVNAKPGDTVNIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIKPGELIVDPNPDKSFDTAVYP
DRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGGFANNDLVEQRTQFFDGGVNVGDTTV
PTTPTTPVTTPTDDSNAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPN
PDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGGFANNDLVEQKTQFF
DGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEI
IEIEPGDIIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGGF
ANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANC
DFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPDRKIIVFLFAEDSGTGAYAITKDGVFATIVAKVKEGAPN
GLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDTVNAKPGDTVRIPV
RFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGELIVDPNPTKSFDTAVYPDRKMIVFLFAEDSGTGAYAITEDGVF
ATIVAKVKSGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAVRIKVDT
VNAKPGDTVRIPVRFSGIPSKGIANCDFVYSYDPNVLEIIEIEPGDIIVDPNPDKSFDTAVYPDRKIIVFLFAEDS
GTGAYAITKDGVFATIVAKVKEGAPNGLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGDTTVPTTSPTTTPPEPT
ITPNKLTLKIGRAEGRPGDTVEIPVNLYGVPQKGIASGDFVVSYDPNVLEIIEIEPGELIVDPNPTKSFDTAVYPD
RKMIVFLFAEDSGTGAYAITEDGVFATIVAKVKEGAPEGFSAIEISEFGAFADNDLVEVETDLINGGVLVTNKPVI
EGYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANVV
VTGDTSVSTSQAPIMMWVGDIVKDNSINLLDVAEVIRCFNATKGSANYVEELDINRNGAINMQDIMIVHKHFGATS
SDYDAQ
Sequence length
1853 AA
Subcellular Location
Secreted (Cell surface)
Function
Cellulose-binding, multicellulase-containing protein complex, termed the cellulosome, which displays endo-glucanase and glucohydrolase activity and mediates strong adherence of the bacterium to the insoluble substrate. Also called cellulose-interacting protein A.
 
 
Glycosylation Status
Glycosylation Type
O(Thr)-linked
 
 
Glycan Information
Glycan Annotation
Linkage: Gal→Thr. Gal as the major component, Glc, GlcNAc, and an unknown monosaccharide residue were detected. The total carbohydrate content was 6.8% (w/w). Tetrasaccharide is a component of the S1 subunit of the cellulosome (from SDS-PAGE experiments).
BCSDB ID
 
 
Literature
Reference(s)
1) Bayer EA, Shoham Y, Lamed R (2000) The Cellulosome. An Extracellular Organelle for Degrading Plant Cell Wall Polysaccharides. In: Doyle RJ (ed) Glycomicrobiology.Kluwer Academic/Plenum Publishers, New York, p 387
2) Shoham, Y., Lamed, R. and Bayer, E.A. (1999) The cellulosome concept as an efficient microbial strategy for the degradation of insoluble polysaccharides. Trends Microbiol, 7, 275-281. [PubMed: 10390637]
3) Gerwig, G.J., Kamerling, J.P., Vliegenthart, J.F., Morag, E., Lamed, R. and Bayer, E.A. (1993) The nature of the carbohydrate-peptide linkage region in glycoproteins from the cellulosomes of Clostridium thermocellum and Bacteroides cellulosolvens. J Biol Chem, 268, 26956-26960. [PubMed: 8262930]
4) Gerwig, G.J., Kamerling, J.P., Vliegenthart, J.F., Morag, E., Lamed, R. and Bayer, E.A. (1991) Primary structure of O-linked carbohydrate chains in the cellulosome of different Clostridium thermocellum strains. Eur J Biochem, 196, 115-122. [PubMed: 2001693]
5) Gerwig, G.J., de Waard, P., Kamerling, J.P., Vliegenthart, J.F., Morgenstern, E., Lamed, R. and Bayer, E.A. (1989) Novel O-linked carbohydrate chains in the cellulase complex (cellulosome) of Clostridium thermocellum. 3-O-Methyl-N-acetylglucosamine as a constituent of a glycoprotein. J Biol Chem, 264, 1027-1035. [PubMed: 2910842]
Year of Identification
1989
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.