Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU154
Organism Information
Organism Name
Deinococcus radiodurans
Domain
Bacteria
Classification
Family: Deinococcaceae
Order: Deinococcales
Class: Deinococci
Division or phylum: "Deinococcus-Thermus"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
hpi
 
 
Protein Information
Protein Name
HPI ( hexagonally packed intermediate) layer polypeptide
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|P13126|HPI2_DEIRA Hexagonally packed intermediate-layer surface protein OS=D
einococcus radiodurans GN=hpi PE=1 SV=1MKKNIALMALTGVLTLASCGQNGNTPTADTTAPTVSL
SVNNANLPSGVGSVVLSGTVNEASTVVVKNNAGTTVCTVEVAASGTFTCPATTIAGNTSTTSTSTSYTATATDAAK
NVGTSSVVTVNVAGVSNPAPTTAVLTIDLAGVSSAPITIKDANGNVVQGYDNVTVNDNATITVARGVYTVTAGNVS
GFNGPTTNFRVDLSGGNQTVTLNYTQAGTTTPTPVGSINILTPAVGTSVTGGSTVRVTFDKANEVQCMVGGAAAVT
AQVDSTSGYCDVVVPNSTGNVVITVMGKGVNGQTVTATRNISVTQAAVSYGVVTPAGDQELTLTSEGIVRDADSGW
RRLGQGVSTPSDPNLNLDIYIKGTVNFSVNAPAGQKVELFLARTTGSDVPTNDDIQAGDVLRSVASTSGTETFSLD
SRRLAEFDGVRKWIVVRINGTQVTYQPVIADNKGPQQPDPELNGVQNAYSNILNNYNNSGLTYVRGPVNVFTSNPS
LQDREFGQAPVGSSFVQRRPAGFESIRYYLVPESAFNNKALQESDEMLRAKAVKSVATVVSAPVLEPGTVKATSFS
RVIGSGATSTVAPKALDNVTYRVYAISRDQVGNETASATYDLVRFDNVGPTITGSVIRDTSDLPFPSQEPERCLSD
IATISLGGIADNVGGVGLNPGQGLTFTLGGRQIQAGQFDTNQLADPEYTIGFNSLTDALGNPVVTAPTNAKVYIDN
TDPTVNFNRAVMQGTYASGGRVSVESDASDGGCGVYETRLFWDTANGVVDDATTTPAIGHPVQFARQRVTDGAKAD
SLNAGWNALQLPNGAGAVYLRSLVVDRAGNATISTTSIVVNAKITNQARPLLGGFDAFKRNASAQFVGDDNVIAGV
NGTAATPNVTGNSALDNILSLDSVGTLTTNAYLPRGATETAITEKIRNVGAYGRFDATQWNLIRDYQLNTDPTLRS
AYVNAGNLANQRGNNWRIRTPWVELGSSDTANTQQKFDFNSDLLNDFYYGRTFGNNHSVNLFSYDQFNGVVSDTAG
AYSFYGETVRK
Sequence length
1036 AA
Subcellular Location
Surface (secreted)
Function
The function(s) of bacterial S layers is still somewhat enigmatic. A primordial function of perpetual importance is shape maintenance and possibly shape determination.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Detection of sugars by GC-MS technique after their conversion into alditol acetates.
 
 
Glycan Information
Glycan Annotation
6 tightly bound sugar residues per polypeptide chain.
 
 
Literature
Reference(s)
1) Peters, J., Peters, M., Lottspeich, F., Schafer, W. and Baumeister, W. (1987) Nucleotide sequence analysis of the gene encoding the Deinococcus radiodurans surface protein, derived amino acid sequence, and complementary protein chemical studies. J Bacteriol, 169, 5216-5223. [PubMed: 3667529]
Year of Identification
1987
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.