Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU163
Organism Information
Organism Name
Escherichia coli (ETEC) strain H10407
Domain
Bacteria
Classification
Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea and hemorrhagic colitis.
 
 
Gene Information
Gene Name
etpA (ETEC_p948_0110)
 
 
Protein Information
Protein Name
EtpA Adhesin
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|E3PP99|E3PP99_ECOH1 Two-partner secreted adhesin EtpA OS=Escherichia coli O7
8:H11 (strain H10407 / ETEC) GN=etpA PE=4 SV=1MNRIYKLKFDKRRNELVVVSEITTGVGNAK
ATGSVEGEKSPRRGVRAMALSLLSGMMIMAHPAMSANLPTGGQIVAGSGSIQTPSGNQMNIHQNSQNMVANWNSFD
IGKGNTVQFDQPSSSAVALNRVVGGGESQIMGNLKANGQVFLVNPNGVLFGEGASVSTSGFVASTRDIKNDDFMNR
RYTFSGGQKAGAAIVNQGELTTNAGGYIVLAADRVSNSGTIRTPGGKTVLAASERITLQLDNGGLMSVQVTGDVVN
ALVENRGLVSARDGQVYLTALGRGMLMNTVLNVSGVVEASGMHRQDGNIVLDGGDSGVVHLSGTLQADNASGQGGK
VVVQGKNILLDKGSNITATGGQGGGEVYVGGGWQGKDSNIRNADKVVMQGGARIDVSATQQGNGGTAVLWSDSYTN
FHGQISAKGGETGGNGGRVETSSHGNLQAFGTVSASAKKGKAGNWLLDSADITIVNGSNVSKTETTQSPPHTQFAP
TAAGSAVSNTSINNRLNNGTSVTILTHRTRTGTAQGGNITVNAAINKSNGSDVNLTLQAGGNITVNNSITSTEGKL
NVNLSGARTSNGSITISNNANITTNGGDITVGTTNTSNRVNISINNTTLNASNGNIQLTGTGTDSGILFAGNNRLT
ASNIALTGNSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTT
TLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSI
TANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNA
TNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTT
TLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSI
TANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNA
TNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTT
TLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSI
TANGTATANGKATHLDGNVTLNASNGRIKLTGNGHGSASGILFAGNNRLTASNIALTGNSTSGNAINLTGTATLNA
TNDITLTGSSTSGNAINLTGTATLNATNNITLTGSSTSGNAINLKGNNTLTASNITLTGESTSGNAINLTDTTGTT
TLNATNNITMQGTRVQIKHSNITAGNFALNATVAGSEISNTTLTATNNINLAAKTNSASSGVYLKDARITSTNGSI
TANGTAPANDNATYLDGNVTLNASNGSIKLTGNGNGSTSGILFAGNNTLTASNITLTGNSEVYWQ
Sequence length
1539 AA
Subcellular Location
Secreted
Function
EtpA adhesin has a role in bridging flagella and host cells. Colonization by ETEC H10407 is prevented by immunizing mice with recombinant, full length EtpA glycoprotein.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
DIG (digoxigenin) Glycan detection
 
 
Glycan Information
Glycan Annotation
6-deoxy-Tal-Thr.
 
 
Literature
Reference(s)
1) Roy, K., Hamilton, D., Ostmann, M.M. and Fleckenstein, J.M. (2009) Vaccination with EtpA glycoprotein or flagellin protects against colonization with enterotoxigenic Escherichia coli in a murine model. Vaccine, 27, 4601-4608. [PubMed: 19523914]
Year of Identification
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.