Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU164
Organism Information
Organism Name
Escherichia coli (ETEC) strain H10407
Domain
Bacteria
Classification
Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhoea and hemorrhagic colitis.
 
 
Gene Information
Gene Name
tibA (ETEC_2141)
 
 
Protein Information
Protein Name
TibA (outer membrane protein synthesized as preTibA)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|Q9XD84|TIBA_ECOLX Adhesin/invasin TibA autotransporter OS=Escherichia coli G
N=tibA PE=1 SV=1MNKVYNTVWNESTGTWVVTSELTRKGGLRPRQIKRTVLAGLIAGLLMPSMPALAAAYDNQ
TIGRGETSKSMHLSAGDTAKNTTINSGGKQYVSSGGSATSTTINIGGVQHVSSGGSATSSTINSGGHQHVSSGGSA
TNTTVNNGGRQTVFSGGSAMGTIINSGGDQYVISGGSATSASVTSGARQFVSSGGIVKATSVNSGGRQYVRDGGSA
TDTVLNNTGRQFVSSGGSAAKTTINSGGGMYLYGGSATGTSIYNGGRQYVSSGGSATNTTVYSGGRQHVYIDGNVT
ETTITSGGMLQVEAGGSASKVIQNSGGAVITNTSAAVSGTNDNGSFSIAGGSAVNMLLENGGYLTVFDGHQASDTM
VGSDGTLDVRSGGVLYGTTTLTDKGALVGDVVTNEGNLYYLNNSTATFTGTLTGTGTLTQEGGNTRFSGLLSQDGG
IFLQSGGAMTMDALQAKANVTTQSGTTLTLDNGTILTGNVAGDSTGAGDMAVKGASVWHLDGDSTVGALTLDNGTV
DFRPSTTTRMTPAFQAVSLALGSLSGSGTFQMNTDIASHTGDMLNVAGNASGNFVLDIKNTGLEPVSAGAPLQVVQ
TGGGDAAFTLKGGKVDAGTWEYGLSKENTNWYLKADTPPPVTPPTNPDADNPDAGNPDAGNPDAGNPDAGNPDAGK
PGTGKPDAGTSSSPVRRTTKSVDAVLGMATAPAYVFNSELDNLRFRHGDVMQNTRAPGGVWGRYTGSDNRISGGAS
SGYTLTQNGFETGADMVFDLSDSSLAVGTFFSYSDNSIKHARGGKSNVDSSGGGLYATWFDNDGYYVDGVLKYNRF
NNELRTWMSDGTAVKGDYSQNGFGGSLEAGRTFSLNENAWAQPYVRTTAFRADKKEIRLNNGMKASIGATKSLQAE
AGLKLGMTLDVAGKEVKPYLSAAVSHEFSDNNKVRINDTYDFRNDISGTTGKYGLGVNAQLTPNAGVWAEARYENG
KQTESPITGGVGFRINF
Sequence length
989 AA
Subcellular Location
Secreted (surface associated)
Function
Adhesion-invasion protein of enterotoxigenic E. coli. Secreted as autotransporter, which represents a branch of the type V secretion pathway. Mediates bacterial autoaggregation and biofilm formation as well as adhesion to and invasion of mammalian cells.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Oxidation of the glycans with periodate and labeling with hydrazide-conjugated digoxigenin (DIG).
 
 
Glycan Information
Glycan Annotation
6-deoxy-Tal-Thr. Multiple heptoses.
 
 
Literature
Reference(s)
1) Lindenthal, C. and Elsinghorst, E.A. (1999) Identification of a glycoprotein produced by enterotoxigenic Escherichia coli. Infect Immun, 67, 4084-4091. [PubMed: 10417177]
Year of Identification
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.