Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU168
Organism Information
Organism Name
Geobacillus (formerly Bacillus) stearothermophilus ATCC 12980/G+
Domain
Bacteria
Classification
Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
sbsD
 
 
Protein Information
Protein Name
SbsD (S-layer glycoprotein)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q9KIQ5|Q9KIQ5_GEOSE SbsD OS=Geobacillus stearothermophilus GN=sbsD PE=4 SV=1
MDKKKAVKLATASAVAASAFVAANPHASQAATDVATVVSQAKAQMKEAYYTYSHTVTETG KLPNISDVYAAYNK
AKQAYANAVAVVNKAGGAKKDAYLADLQATYETYVFKANPKSGEAR VATYIDAYNYATKLDAMRQELKAAVEAKD
LKKAEELYHKISYELKTRTVILDRVYGQSTR ELLRSTFKADAQALRDSLIYDITVAMKAREAQDAAKAGNLDKAK
AALDQVNQYVSKVTDA FKAELQKAAQDANAAYEAALPPKVESVTAVNAKTLEIKFNKAVDVATVIDNKGTSDTSD
D VVKATAITLTAIDGQGSVSTVKASLSDDKKTLKLVADGSQFFTKRYVVDIKNVKTLDGKD VPSYTTTIDTTDS
VRPSVLSSSYADNGLTLKVKFSEPLASVGTVKLYDGTTEISVSPKFT AGDDEMTINLASSSVPVNKDLTLKIFGA
VDYNGNVINPNPAELTVKKTTVDTTKPTVQNI EAVNTKTVKVTFSEKLLSNPTIKIGGQTASVSVDSTGLVYTAT
LANALSEGVYAVEVSDY KDLAGNAGDTYTKVVQLKADTTAPKFVSSQVVKIDGVEHLVLTFDEEVTTGSNITVVQ
AS DKYVDENNVLKSVGTTLTTTSDNFKLYLPTDGKSKSVALNISSLPKGTYTVTLPDRLVSD LAGNPYAERKQI
TFVRGSDSLTTKPALDSSYDNNGVKADNNNELVFAFTQNLDASALNLS NFNINGLAVTKAVFDGDTKHIRVTLAP
GANTWTGTHVITISNIKNTSGLVMDTVTVSEFM KENVAPTFTATLTSADVIRVDFSEPVANATISSPLSANNFTV
KVDGNVVTVSNVYEDNNA TNQVQGSTGYKTVYLKLQSPVSDLSKPITLSATGIVDVDQTGAITNNNLVGNNVSNA
VVN VAK
Sequence length
903 AA
Subcellular Location
Surface
Function
Biosynthesis of S-layer glycoprotein occurs due to S-layer variation at higher temperature.
 
 
Glycosylation Status
Glycosylation Type
O(Ser/Thr)- linked
Technique(s) used for Glycosylation Detection
Periodate-Schiff (PAS) reagent staining, deglycosylation with trifluoromethanesulfonic acid
 
 
Glycan Information
Glycan Annotation
Contains mannose, glucose, galactose and rhamnose as revealed by neutral sugar and amino sugar analysis. These sugars are present in a molar ratio of 1.85, 1, 1.02 and 0.78, respectively. Glycan chains are bound via O-linkage to serine or threonine residues.
 
 
Literature
Reference(s)
1) Egelseer, E.M., Danhorn, T., Pleschberger, M., Hotzy, C., Sleytr, U.B. and Sara, M. (2001) Characterization of an S-layer glycoprotein produced in the course of S-layer variation of Bacillus stearothermophilus ATCC 12980 and sequencing and cloning of the sbsD gene encoding the protein moiety. Arch Microbiol, 177, 70-80. [PubMed: 11797047]
Year of Identification
2001
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.