Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU212
Organism Information
Organism Name
Mycobacterium tuberculosis
Domain
Bacteria
Classification
Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
It is the causative agent of human tuberculosis. The pathogenesis is influenced by its lipoglycans and glycolipids (having a wide range of immunomodulatory activities), and a variety of its virulence factors and antigens.
 
 
Gene Information
Gene Name
pon1 (Rv3682)
NCBI Gene ID
 
 
Protein Information
Protein Name
PonA2
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q7D529|Q7D529_MYCTU Penicillin-binding protein 1 OS=Mycobacterium tuberculos
is GN=pon1 PE=4 SV=1 MPERLPAAITVLKLAGCCLLASVVATALTFPFAGGLGLMSNRASEVVANGSAQLL
EGQVP AVSTMVDAKGNTIAWLYSQRRFEVPSDKIANTMKLAIVSIEDKRFADHSGVDWKGTLTGL AGYASGDLD
TRGGSTLEQQYVKNYQLLVTAQTDAEKRAAVETTPARKLREIRMALTLDKT FTKSEILTRYLNLVSFGNNSFGVQ
DAAQTYFGINASDLNWQQAALLAGMVQSTSTLNPYT NPDGALARRNVVLDTMIENLPGEAEALRAAKAEPLGVLP
QPNELPRGCIAAGDRAFFCDY VQEYLSRAGISKEQVATGGYLIRTTLDPEVQAPVKAAIDKYASPNLAGISSVMS
VIKPGK DAHKVLAMASNRKYGLDLEAGETMRPQPFSLVGDGAGSIFKIFTTAAALDMGMGINAQLD VPPRFQAK
GLGSGGAKGCPKETWCVVNAGNYRGSMNVTDALATSPNTAFAKLISQVGVGR AVDMAIKLGLRSYANPGTARDYN
PDSNESLADFVKRQNLGSFTLGPIELNALELSNVAAT LASGGVWCPPNPIDQLIDRNGNEVAVTTETCDQVVPAG
LANTLANAMSKDAVGSGTAAGS AGAAGWDLPMSGKTGTTEAHRSAGFVGFTNRYAAANYIYDDSSSPTDLCSGPL
RHCGSGD LYGGNEPSRTWFAAMKPIANNFGEVQLPPTDPRYVDGAPGSRVPSVAGLDVDAARQRLKD AGFQVAD
QTNSVNSSAKYGEVVGTSPSGQTIPGSIVTIQISNGIPPAPPPPPLPEDGGPP PPVGSQVVEIPGLPPITIPLLA
PPPPAPPP
Sequence length
810 AA
Subcellular Location
Membrane associated
Function
Penicillin-binding protein with transglycosylase and transpeptidase activities.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
Concanavalin A (ConA) binding
 
 
Literature
Reference(s)
1) Gonzalez-Zamorano, M., Mendoza-Hernandez, G., Xolalpa, W., Parada, C., Vallecillo, A.J., Bigi, F. and Espitia, C. (2009) Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res, 8, 721-733. [PubMed: 19196185]
Year of Identification
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.