Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU239
Organism Information
Organism Name
Paenibacillus (Bacillus) alvei CCM 2051
Domain
Bacteria
Classification
Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
spaA
 
 
Protein Information
Protein Name
S-layer glycoprotein
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|C1JZ07|C1JZ07_PAEAL Surface (S-) layer glycoprotein OS=Paenibacillus alvei G
N=spaA PE=4 SV=1 MKKRLALLLSVAMAFSMFANVAFGADAAKTTQEKFDALKEAGVFSGYPGTTDAKLGQDM
T RAEFAKVLVKLFGLKEIHGQYSYKDKNYDAKNWAAPFIEAVTAEGLMQGKDLTKKIFDFN GKITVEEASKTLV
TALKLEPVKDAQNKATDWAKGYFEAAVNAGLFSKDANPKANATRAQL VEAAFAADEMSKGPKVTSYKVIDSKTVE
FTMSDKEVQKVTLDKALEPNKETEVTFTYKNK EGKEFKITTKVTYTITAAQKIESVTAENLKEVVVKFDGSLDKK
SAEKADNYEVKDAKVDS AKLIDKNTVYVLLKEEDSSTMKNQKEIELKVKGVQNEDKSKTFDEKVKFTPMDVKTPE
AK EVVGLGTKAFKVVFSEPVKKSGVFTTSNYKVDGKTVSASVKYVYPNIAIVSTDLSVGEHK LTVSNVEDFSGL
KIAPVEKTFTIAEDTTAPKVVSAKAKDPMELEIEFNETVKSISKIYHG NSSNTGEVKIKDNIVTVKFEKSKALYL
GENTVYIEGATDYSNNKANREVKVNPSLDAERP EVEKVELKNSDHQIILTFNKELDAASATNRDNYFLKDKDGKF
FKHDAVNKNDGKILTTPT YKKDKKTVTIDLIKPLDEGDYILEVNGVKDNAYVSNTMLPFSKKITADAKSGPARAW
TNY DANQDYIYIQFPKAVKTDGDGDATIKAKYTVFGKSLNDDYETPVLVQPDTIRIDAKRGTL LTTDGEVKNPY
SPDVGATLIKDIDGDWFEGGENYKVEVKELGDAKVTWAEKATVKDRNEL KVKLTGKLNNVDVSDFKVTTVDGPKV
PNSYQQDGNTLTLKFNDSNKLPVDLFGAQLVAVN DNSTDTFGNRIQKFTVDVNGELRPEATSVVVNKATVTGATY
EAVVSVNSVVYTDFADTAQ FIKFFGVEVDSQKADIVKIEAATDGKAEQKSFKILFNLPTSVKEVKSDTRFRVELQ
DKGT SVVRDRQGNVIQDFYLPGTYSGK
Sequence length
983 AA
Subcellular Location
Surface
Function
Structural component of the surface layer.
 
 
Glycosylation Status
Glycosylation Type
O(Tyr)- linked
Technique(s) used for Glycosylation Detection
Carbohydrate determination
 
 
Glycan Information
Glycan Annotation
β-D-Galp-(1→O)-Tyr glycosidic linkage unit. The glycan chains consist on average of twenty branched trisaccharide repeating units with the structure [→3)-β-D-Galp-(1→4)-[α-D-Glcp-(1→6)-]-β-D-ManpNAc-(1→]n. This O-antigen-like domain of the polysaccharide is connected with the S-layer polypeptide through the ‘‘core’’ structure →3)[GroA-(2→O)-PO2-(O→4)-β-D-ManpNAc-(1→4)]-α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-Galp-(1→O)-Tyr. Except for the substitution in position 4 of the nonreducing rhamnose with the modified glyceric acid phosphate residue GroA-2→OPO2→4-β-D-ManpNAc-(1→, this core is identical to the core of the Tyr-linked glycan from the S-layer glycoprotein of Tb. thermohydrosulfuricus L111-69.
BCSDB ID
 
 
Literature
Reference(s)
1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
2) Messner, P., Christian, R., Neuninger, C. and Schulz, G. (1995) Similarity of "core" structures in two different glycans of tyrosine-linked eubacterial S-layer glycoproteins. J Bacteriol, 177, 2188-2193. [PubMed: 7721708]
3) Altman, E., Brisson, J.R., Messner, P. and Sleytr, U.B. (1991) Structure of the glycan chain from the surface layer glycoprotein of Bacillus alvei CCM 2051. Biochem Cell Biol, 69, 72-78. [PubMed: 2043344]
Year of Identification
1991
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.