Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU246
Organism Information
Organism Name
Porphyromonas (Bacteroides) gingivalis W50
Domain
Bacteria
Classification
Family: Porphyromonadaceae
Order: Bacteroidales
Class: Bacteroidia
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
Organism Additional Information
Porphyromonas gingivalis is a Gram-negative anaerobic bacterium responsible for causing adult periodontal disease, a chronic inflammatory condition of the periodontal tissues. It is the source of a number of virulence factors that are thought to be important for deregulation of innate and inflammatory systems in the host.
 
 
Gene Information
Gene Name
rgpA
 
 
Protein Information
Protein Name
Cysteine proteases (extracellular) Arg-gingipains (RgpA)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|P28784|CPG1_PORGI Gingipain R1 OS=Porphyromonas gingivalis GN=rgpA PE=1 SV=2
MKNLNKFVSIALCSSLLGGMAFAQQTELGRNPNVRLLESTQQSVTKVQFRMDNLKFTEVQ TPKGMAQVPTYTEG
VNLSEKGMPTLPILSRSLAVSDTREMKVEVVSSKFIEKKNVLIAPS KGMIMRNEDPKKIPYVYGKSYSQNKFFPG
EIATLDDPFILRDVRGQVVNFAPLQYNPVTK TLRIYTEITVAVSETSEQGKNILNKKGTFAGFEDTYKRMFMNYE
PGRYTPVEEKQNGRMI VIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTY
V LLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYER NITTEDKWLGQAL
CIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPK NIIDAFNGGISLVNYTGHGSETAWGTSH
FGTTHVKQLTNSNQLPFIFDVACVNGDFLFSM PCFAEALMRAQKDGKPTGTVAIIASTINQSWASPMRGQDEMNE
ILCEKHPNNIKRTFGGV TMNGMFAMVEKYKKDGEKMLDTWTVFGDPSLLVRTLVPTKMQVTAPAQINLTDASVNV
SC DYNGAIATISANGKMFGSAVVENGTATINLTGLTNESTLTLTVVGYNKETVIKTINTNGE PNPYQPVSNLTA
TTQGQKVTLKWDAPSTKTNATTNTARSVDGIRELVLLSVSDAPELLRS GQAEIVLEAHDVWNDGSGYQILLDADH
DQYGQVIPSDTHTLWPNCSVPANLFAPFEYTVP ENADPSCSPTNMIMDGTASVNIPAGTYDFAIAAPQANAKIWI
AGQGPTKEDDYVFEAGKK YHFLMKKMGSGDGTELTISEGGGSDYTYTVYRDGTKIKEGLTETTYRDAGMSAQSHE
YCV EVKYAAGVSPKVCVDYIPDGVADVTAQKPYTLTVVGKTITVTCQGEAMIYDMNGRRLAAG RNTVVYTAQGG
YYAVMVVVDGKSYVEKLAVK
Sequence length
991 AA
Subcellular Location
Extracellular
Function
Cysteine proteases cause the degradation of several physiologically important proteins, including collagens, fibrin and fibrinogen and fibronectin. They also account for deregulatory effects on several host systems and are therefore considered important virulence determinants. The adhesin domains of Arg-gingipains mediate the adherence of P. gingivalis to epithelial cells.
 
 
Glycosylation Status
Glycosylation Type
Information currently not available with us.
Technique(s) used for Glycosylation Detection
PAS staining, biotin hydrazide labelling following periodate oxidation and subsequent abolishment of immunoreactivity wth MAb 1B5 and MAb 7B4 after deglycosylation.
 
 
Glycan Information
Glycan Annotation
Linkage: GalN(Ac)-Ser/Thr. Ara, Rha, Fuc,Man, Gal, Glc, GalN(Ac), GlcN(Ac), and N-acetylneuraminic acid (NANA) totalling 14.4% by weight of protein. The glycan chains are structurally and immunologically related to the cell surface polymer of this Gram-negative bacterium.
 
 
Literature
Reference(s)
1) Paramonov, N., Rangarajan, M., Hashim, A., Gallagher, A., Aduse-Opoku, J., Slaney, J.M., Hounsell, E. and Curtis, M.A. (2005) Structural analysis of a novel anionic polysaccharide from Porphyromonas gingivalis strain W50 related to Arg-gingipain glycans. Mol Microbiol, 58, 847-863. [PubMed: 16238632]
2) Rangarajan, M., Hashim, A., Aduse-Opoku, J., Paramonov, N., Hounsell, E.F. and Curtis, M.A. (2005) Expression of Arg-Gingipain RgpB is required for correct glycosylation and stability of monomeric Arg-gingipain RgpA from Porphyromonas gingivalis W50. Infect Immun, 73, 4864-4878. [PubMed: 16041000]
3) Curtis, M.A., Thickett, A., Slaney, J.M., Rangarajan, M., Aduse-Opoku, J., Shepherd, P., Paramonov, N. and Hounsell, E.F. (1999) Variable carbohydrate modifications to the catalytic chains of the RgpA and RgpB proteases of Porphyromonas gingivalis W50. Infect Immun, 67, 3816-3823. [PubMed: 10417143]
4) Rangarajan, M., Smith, S.J., U, S. and Curtis, M.A. (1997) Biochemical characterization of the arginine-specific proteases of Porphyromonas gingivalis W50 suggests a common precursor. Biochem J, 323 ( Pt 3), 701-709. [PubMed: 9169603]
Year of Identification
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.