Total Record - 1

Print this rrecord

 
ProGlyProt ID
BU257
Organism Information
Organism Name
Pseudomonas syringae strain S203
Domain
Bacteria
Classification
Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
Organism Additional Information
Pseudomonas syringae (Gram-negative bacterium) is phytopathogenic.
 
 
Gene Information
Gene Name
inaZ
 
 
Protein Information
Protein Name
Ice nucleation lipoglycoprotein
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|P06620|ICEN_PSESY Ice nucleation protein OS=Pseudomonas syringae pv. syringa
e GN=inaZ PE=1 SV=1 MNLDKALVLRTCANNMADHCGLIWPASGTVESRYWQSTRRHENGLVGLLWGAGTSA
FLSV HADARWIVCEVAVADIISLEEPGMVKFPRAEVVHVGDRISASHFISARQADPASTSTSTL TPMPTAIPTP
MPAVASVTLPVAEQARHEVFDVASVSAAAAPVNTLPVTTPQNVQTATYGS TLSGDNHSRLIAGYGSNETAGNHSD
LIAGYGSTGTAGSDSWLVAGYGSTQTAGGDSALTA GYGSTQTAREGSNLTAGYGSTGTAGSDSSLIAGYGSTQTS
GGDSSLTAGYGSTQTAQEGS NLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYG
STGTA GVDSSLIAGYGSTQTSGSDSALTAGYGSTQTAQEGSNLTAGYGSTGTAGSDSSLIAGYGS TQTSGSDSS
LTAGYGSTQTAQEGSILTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSALTA GYGSTQTAQEGSNLTAGYGSTGTA
GADSSLIAGYGSTQTSGSESSLTAGYGSTQTAREGS TLTAGYGSTGTAGADSSLIAGYGSTQTSGSESSLTAGYG
STQTAQQGSVLTSGYGSTQTA GAASNLTTGYGSTGTAGHESFIIAGYGSTQTAGHKSILTAGYGSTQTARDGSDL
IAGYGS TGTAGSGSSLIAGYGSTQTASYRSMLTAGYGSTQTAREHSDLVTGYGSTSTAGSNSSLIA GYGSTQTA
GFKSILTAGYGSTQTAQERTSLVAGYGSTSTAGYSSSLIAGYGSTQTAGYES TLTAGYGSTQTAQENSSLTTGYG
STSTAGYSSSLIAGYGSTQTAGYESTLTAGYGSTQTA QERSDLVTGYGSTSTAGYASSLIAGYGSTQTAGYESTL
TAGYGSTQTAQENSSLTTGYGS TSTAGFASSLISGYGSTQTAGYKSTLTAGYGSTQTAEYGSSLTAGYGSTATAG
QDSSLIA GYGSSLTSGIRSFLTAGYGSTLIAGLRSVLIAGYGSSLTSGVRSTLTAGYGSNQIASYGS SLIAGHE
SIQVAGNKSMLIAGKGSSQTAGFRSTLIAGAGSVQLAGDRSRLIAGADSNQTA GDRSKLLAGNNSYLTAGDRSKL
TGGHDCTLMAGDQSRLTAGKNSVLTAGARSKLIGSEGS TLSAGEDSILIFRLWDGKRYRQLVARTGENGVEADIP
YYVNEDDDIVDKPDEDDDWIEVK
Sequence length
1200 AA
Subcellular Location
Outer membrane
Function
It helps in nucleating ice formation in supercooled water.
 
 
Protein Structure
PDB ID
1INA, 1INB
 
 
Glycosylation Status
Glycosylation Type
N(Asn), O(Ser/Thr)-linked
Technique(s) used for Glycosylation Detection
Enzyme treatment, deglycosylation (O- and N- glycans).
 
 
Glycan Information
Glycan Annotation
Linkages: Man-N-Asn, Gal-O-Ser, Gal-O-Thr.
 
 
Literature
Reference(s)
1) Kozloff, L.M., Turner, M.A. and Arellano, F. (1991) Formation of bacterial membrane ice-nucleating lipoglycoprotein complexes. J Bacteriol, 173, 6528-6536. [PubMed: 1917877]
2) Turner, M.A., Arellano, F. and Kozloff, L.M. (1991) Components of ice nucleation structures of bacteria. J Bacteriol, 173, 6515-6527. [PubMed: 1917876]
Year of Identification
1991
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.